DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44002 and ZBTB37

DIOPT Version :9

Sequence 1:NP_608754.1 Gene:CG44002 / 33535 FlyBaseID:FBgn0264744 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001116242.1 Gene:ZBTB37 / 84614 HGNCID:28365 Length:503 Species:Homo sapiens


Alignment Length:376 Identity:88/376 - (23%)
Similarity:130/376 - (34%) Gaps:101/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RVCL-----------ASSKNMVNIFE------ERQDLPVSIAHMIIECTGFKVEKGDSLP--HSI 51
            |:||           ||...|.:|.:      |.....:::|.:..|.:..:.:..:..|  |.:
Human    91 RICLQLADIISYLTAASFLQMQHIIDKCTQILEGIHFKINVAEVEAELSQTRTKHQERPPESHRV 155

  Fly    52 CP---PCVKDAHNAFTIIKTYERSYQV--FYEVQDTVLEEELSEDVIIELS---DSDEVIL---- 104
            .|   ..:...||.    ....|..||  ..::::....||.:...|||.|   :|.|.||    
Human   156 TPNLNRSLSPRHNT----PKGNRRGQVSAVLDIRELSPPEESTSPQIIEPSSDVESREPILRINR 216

  Fly   105 ---------------IDEQEEKV---------HLSENKAPTNEVSTQEESKTAQ-SDNVSEDKGH 144
                           ..:.|.:|         :|.|...|.|:.|.::.|...: :..|.:..||
Human   217 AGQWYVETGVADRGGRSDDEVRVLGAVHIKTENLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGH 281

  Fly   145 --------ICTQCHMSFRRP---------------GLLELHILRHHT---TDGPR-PMSSTSEHA 182
                    ..........||               .|.|.|..|..:   .|.|: |.|...|.|
Human   282 GSVGQENYTLGSSGAKVARPTSSEVDRFSPSGSVVPLTERHRARSESPGRMDEPKQPSSQVEESA 346

  Fly   183 VK---------EELRTKARQLSRNSTHTCRLCNKTFCSKASCVRHQKTHTGEKPFACEICQKPFA 238
            :.         .|.....|....|...||..|.|:|..|.|..||.:.|.|..||.|.:|.|.:.
Human   347 MMGVSGYVEYLREQEVSERWFRYNPRLTCIYCAKSFNQKGSLDRHMRLHMGITPFVCRMCGKKYT 411

  Fly   239 DLASVKRHLRTHTGERPFKCLTCQSAFSDGSALRQHIR-IHTG----ERPY 284
            ....::.|:|.|||.:||.|..|..:|...:.|.||.| .|.|    |.|:
Human   412 RKDQLEYHIRKHTGNKPFHCHVCGKSFPFQAILNQHFRKNHPGCIPLEGPH 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44002NP_608754.1 zf-AD 5..78 CDD:285071 18/95 (19%)
C2H2 Zn finger 146..166 CDD:275368 5/34 (15%)
COG5048 <162..302 CDD:227381 45/141 (32%)
C2H2 Zn finger 202..222 CDD:275368 8/19 (42%)
zf-H2C2_2 217..238 CDD:290200 9/20 (45%)
C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
zf-H2C2_2 242..266 CDD:290200 9/23 (39%)
C2H2 Zn finger 258..278 CDD:275368 7/20 (35%)
zf-H2C2_2 270..293 CDD:290200 8/20 (40%)
C2H2 Zn finger 286..306 CDD:275368
C2H2 Zn finger 314..333 CDD:275368
ZBTB37NP_001116242.1 BTB_POZ_ZBTB37 7..129 CDD:349531 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..206 14/69 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..344 12/63 (19%)
C2H2 Zn finger 375..395 CDD:275368 8/19 (42%)
zf-H2C2_2 387..412 CDD:404364 10/24 (42%)
zf-C2H2 401..423 CDD:395048 6/21 (29%)
C2H2 Zn finger 403..423 CDD:275368 5/19 (26%)
zf-H2C2_2 416..438 CDD:404364 9/21 (43%)
C2H2 Zn finger 431..449 CDD:275368 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..503 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.