DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44002 and CG15336

DIOPT Version :9

Sequence 1:NP_608754.1 Gene:CG44002 / 33535 FlyBaseID:FBgn0264744 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_572450.4 Gene:CG15336 / 31742 FlyBaseID:FBgn0030009 Length:159 Species:Drosophila melanogaster


Alignment Length:132 Identity:44/132 - (33%)
Similarity:59/132 - (44%) Gaps:13/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 TGEKPFA--------CEICQKPFADLASVKRHLRTHTGERPFKCLTCQSAFSDGSALRQHIRIH- 278
            :.|:|.|        ||.|........:::.|.|.||||.||.|..||:.|.....|:.|:..| 
  Fly     2 SAERPAASSDNRRLMCEFCGYRTRIYWNLQIHRRRHTGEMPFSCQQCQARFPASYQLKSHLERHL 66

  Fly   279 -TGERPYK--CDMCDKFFRERSDARKHMMSHTAEKRFKCSQCERRFRQPKGLRRHVKLCHTDKVE 340
             .|||..:  |..|:..|........|...|...||||||||::.|.|..|..:| |..|..:.:
  Fly    67 DAGERRQRHICTDCNVGFSSSRALYHHRTLHEDGKRFKCSQCDKSFAQAAGYAQH-KRIHRQRNQ 130

  Fly   341 NA 342
            .|
  Fly   131 RA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44002NP_608754.1 zf-AD 5..78 CDD:285071
C2H2 Zn finger 146..166 CDD:275368
COG5048 <162..302 CDD:227381 27/90 (30%)
C2H2 Zn finger 202..222 CDD:275368
zf-H2C2_2 217..238 CDD:290200 6/22 (27%)
C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
zf-H2C2_2 242..266 CDD:290200 11/23 (48%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
zf-H2C2_2 270..293 CDD:290200 8/26 (31%)
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..333 CDD:275368 8/18 (44%)
CG15336NP_572450.4 C2H2 Zn finger 17..37 CDD:275370 5/19 (26%)
zf-H2C2_2 29..52 CDD:290200 11/22 (50%)
C2H2 Zn finger 45..65 CDD:275368 6/19 (32%)
C2H2 Zn finger 77..97 CDD:275368 4/19 (21%)
C2H2 Zn finger 105..125 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.