Sequence 1: | NP_608754.1 | Gene: | CG44002 / 33535 | FlyBaseID: | FBgn0264744 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_008758154.1 | Gene: | Zfp771 / 308992 | RGDID: | 1305903 | Length: | 358 | Species: | Rattus norvegicus |
Alignment Length: | 277 | Identity: | 84/277 - (30%) |
---|---|---|---|
Similarity: | 132/277 - (47%) | Gaps: | 42/277 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 EEELSEDVIIELSDSDEVILIDEQEEKVHLSENKAPTNEVSTQEESKTAQSDNVSEDKGHICTQC 149
Fly 150 HMSFRRPGLLELHILRHHTTDGPRPMSST------------SEH-------------------AV 183
Fly 184 KEELRTKARQLSRNSTHTCRLCNKTFCSKASCVRHQKTHTGEKPFACEICQKPFADLASVKRHLR 248
Fly 249 THTGERPFKCLTCQSAFSDGSALRQHIRIHTGERPYKCDMCDKFFRERSDARKHMMSHTAEKRFK 313
Fly 314 CSQCERRFRQPKGLRRH 330 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG44002 | NP_608754.1 | zf-AD | 5..78 | CDD:285071 | |
C2H2 Zn finger | 146..166 | CDD:275368 | 6/19 (32%) | ||
COG5048 | <162..302 | CDD:227381 | 54/170 (32%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 217..238 | CDD:290200 | 10/20 (50%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 242..266 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 270..293 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 314..333 | CDD:275368 | 8/17 (47%) | ||
Zfp771 | XP_008758154.1 | COG5048 | <82..286 | CDD:227381 | 61/209 (29%) |
C2H2 Zn finger | 106..126 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 119..143 | CDD:290200 | 9/26 (35%) | ||
C2H2 Zn finger | 134..154 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 146..170 | CDD:290200 | 1/23 (4%) | ||
C2H2 Zn finger | 162..182 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 174..199 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 190..210 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 202..225 | CDD:290200 | 10/22 (45%) | ||
C2H2 Zn finger | 218..238 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 231..255 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 246..266 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 258..281 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 274..294 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 286..309 | CDD:290200 | 7/22 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |