Sequence 1: | NP_608754.1 | Gene: | CG44002 / 33535 | FlyBaseID: | FBgn0264744 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006617.1 | Gene: | ZBTB6 / 10773 | HGNCID: | 16764 | Length: | 424 | Species: | Homo sapiens |
Alignment Length: | 332 | Identity: | 80/332 - (24%) |
---|---|---|---|
Similarity: | 132/332 - (39%) | Gaps: | 70/332 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 MIIEC-TG-FKVEKGDSLPHSICPPCVKDAHNAFTIIKTYERSYQVFYEV--------QDTVLEE 86
Fly 87 ELSEDVIIELSDSD---EVILIDEQEE---KVHLSENKAPTNEVSTQEESKTAQSDNVSEDKGHI 145
Fly 146 CTQCHMSFRRPGLLELHILRHHT------------TDGPRPM--SSTSEHAVKEELRTKARQLSR 196
Fly 197 NS----------------------------THTCRLCNKTFCSKASCVRHQKTHTGEKPFACEIC 233
Fly 234 QKPFADLASVKRHLRTHTGERPFKCLTCQSAFSDGSALRQHIRIHTGERPYKCDMCDKFFRERSD 298
Fly 299 ARKHMMS 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG44002 | NP_608754.1 | zf-AD | 5..78 | CDD:285071 | 7/47 (15%) |
C2H2 Zn finger | 146..166 | CDD:275368 | 3/19 (16%) | ||
COG5048 | <162..302 | CDD:227381 | 47/181 (26%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 217..238 | CDD:290200 | 9/20 (45%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 242..266 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 270..293 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 314..333 | CDD:275368 | |||
ZBTB6 | NP_006617.1 | BTB_POZ_ZBTB6 | 8..123 | CDD:349506 | 7/42 (17%) |
C2H2 Zn finger | 303..323 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 326..348 | CDD:395048 | 8/21 (38%) | ||
C2H2 Zn finger | 328..348 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | 331..401 | CDD:406359 | 30/69 (43%) | ||
zf-H2C2_2 | 340..364 | CDD:404364 | 10/23 (43%) | ||
C2H2 Zn finger | 356..376 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 384..401 | CDD:275368 | 6/16 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 402..424 | 1/2 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |