DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Epac

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001097202.2 Gene:Epac / 35588 FlyBaseID:FBgn0085421 Length:1006 Species:Drosophila melanogaster


Alignment Length:414 Identity:70/414 - (16%)
Similarity:129/414 - (31%) Gaps:166/414 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 IVSGP----LDSLIETLLPKDVVDLDKEFVFSFLLSCRLFLRPHELLGRLLD----------SVP 241
            ::||.    |:.|:||.|.:.|..:| .|:..|||:..:|:...:|:..|.:          ..|
  Fly   490 VMSGTPAKMLEHLLETRLGQSVGGMD-PFLDDFLLTHIVFMPVVQLVDELANYFHCDAHEDAQTP 553

  Fly   242 ES-----ECLESLVSLLAEWTMKFPY-DYRDERMMSHVKHIVARCSNSHLEAAVSQTLSALLKRL 300
            |.     ...:.::..:.:|.|...: .:.:..:...::.:.|..   ..:..:::..|.:...|
  Fly   554 EDREYIINFKKRVIQFMQKWVMAVRHAAFEEPSVCDFIEDLAAEV---EADPDLNEETSIVHNVL 615

  Fly   301 TDLERHEAD-------------------------------------------------------- 309
            |.:.|::.|                                                        
  Fly   616 TQMARYQEDRNQNAGQKWKLPPNGQPICLFSGNATPSKTVIRPDDDIIFRVYCADHTYCTLRFPM 680

  Fly   310 ------LRACQTNDK----SGPE------------------TPLNCPTA---------------- 330
                  ::||.. ||    .|||                  ..::.||.                
  Fly   681 HTTAELIKACAA-DKLQLNRGPEDLVLVEVKSNGERSVFKDNDVSIPTGLSLNGRLFVSVKDHLD 744

  Fly   331 --TQYAQIVCRVE-----------KKLAKHIGGEEFLQCSSMILLDKQKKWD----------QPS 372
              ||..:..|..|           |:||.||...|               ||          ...
  Fly   745 ALTQLQEQECPTEGVDIDLEILSTKELAYHITLFE---------------WDLFWAVHEYELLYH 794

  Fly   373 TSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEILQSVGIEGRSRTVELWSGVAQYCLLVGNYN 437
            |.|.   ....|.|.||:.:|.....::.::..|::.:..:..|...|..:..:|.||....|.|
  Fly   795 TFGR---HHFGKITANLDVFLRRFNEVQYWIVTELVSTPSLSKRVGLVRKFIKLAAYCKEYQNLN 856

  Fly   438 SATAILESLESPAIARLKITWSKL 461
            :..|::..|.:.|::||:.||.|:
  Fly   857 AFFAVVMGLSNMAVSRLQQTWEKI 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 20/119 (17%)
RasGEF 334..>473 CDD:279011 33/149 (22%)
EpacNP_001097202.2 Crp 28..>146 CDD:223736
CAP_ED 36..146 CDD:237999
DEP_Epac 199..330 CDD:239884
CAP_ED 352..463 CDD:237999
Crp 373..525 CDD:223736 13/35 (37%)
RasGEF_N 489..594 CDD:279012 20/104 (19%)
UBQ 665..>714 CDD:294102 7/49 (14%)
RasGEF 766..1002 CDD:214539 31/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.