DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34393 and Rgl3

DIOPT Version :9

Sequence 1:NP_001285578.1 Gene:CG34393 / 33534 FlyBaseID:FBgn0085422 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001100275.1 Gene:Rgl3 / 300444 RGDID:1309756 Length:346 Species:Rattus norvegicus


Alignment Length:307 Identity:71/307 - (23%)
Similarity:121/307 - (39%) Gaps:63/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 SECLESLVSLLAEWTMKFPYDYR---DERMMSHVKHIVARCSNSHLEA-AVSQTLSALLKRLTDL 303
            |:.|.::||:|..|....|.|:|   |.:.:..|:..:...:....|. ...:.|...||...: 
  Rat    40 SKNLRAVVSVLGSWLRDHPQDFRDPPDHQNLGDVRIFLGWAAPGGAEVREAEKLLEDFLKEAKE- 103

  Fly   304 ERHEADLRACQTNDKSGPETPLNCPT---ATQYAQIVCRVEKKLAKHIGGEEFLQCS------SM 359
            |:.|.:.|...    :||......|.   |..|::     |:.|...  |.|.|..|      .:
  Rat   104 EQTEGEQRLAW----AGPPWAAQSPRSEFAEDYSE-----EEGLRSE--GPELLDFSVDEVAEQL 157

  Fly   360 ILLDKQ------------KKW---DQPSTSGAPPGAQDPKKTCNLETYLDWSARLRLFVCNEILQ 409
            .|:|.:            ..|   |:|..:|..|..:......|..|..         |...:|.
  Rat   158 TLMDVELFLRVRSCECLGSMWSQRDRPGAAGISPTVRATVAQFNAVTGC---------VLGSVLA 213

  Fly   410 SVGIEG--RSRTVELWSGVAQYCLLVGNYNSATAILESLESPAIARLKITWSKLQVTCQQLDCMQ 472
            :.|:..  |::.:|.|..:||.|..:.|::|..|||.:|:|..|.|||.:|.  .|:.:.|...:
  Rat   214 APGLAASQRAQRIEKWIRIAQRCRELRNFSSLRAILSALQSNPIYRLKRSWG--AVSREPLSVFR 276

  Fly   473 R----HAEGHGHLWQKQAISLNEQQEGLKTDKQAPKEPAAQGAAPTQ 515
            :    .::...||..:..:|..|..||.:.|..:|      |:.|::
  Rat   277 KLSQIFSDEDNHLSSRAILSQEETTEGPQGDDCSP------GSLPSK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34393NP_001285578.1 REM 196..300 CDD:100121 15/60 (25%)
RasGEF 334..>473 CDD:279011 38/161 (24%)
Rgl3NP_001100275.1 REM <36..100 CDD:295342 14/59 (24%)
RasGEF 152..345 CDD:279011 42/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.