DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hydr2 and AT1G34340

DIOPT Version :9

Sequence 1:NP_001245852.1 Gene:Hydr2 / 33532 FlyBaseID:FBgn0014906 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_174694.2 Gene:AT1G34340 / 840335 AraportID:AT1G34340 Length:530 Species:Arabidopsis thaliana


Alignment Length:346 Identity:90/346 - (26%)
Similarity:153/346 - (44%) Gaps:33/346 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YKIAPVLREPYIPPRLWGFSG-------HVQTVLHSIVGRVRCPWPLGERVY-MSLKDGSTLTYD 99
            |...|.|..|:|......|.|       ..|..|.|..|.:...|.....|. .||.:.|.:|  
plant    86 YVATPWLASPHIQTCFLNFHGLPPVFTYTRQLFLTSDGGTIALDWLTNSDVLDGSLHNKSEIT-- 148

  Fly   100 LYQPLNEQEDDITVA-ICPGIANSSESVYIRTFVHLAQCNGYRCAVLNHIGALRSVQVTSTRIFT 163
                   :||...:| :.||:.:.|.|.|::...:.....|:...:.||.| |..|.|||...:.
plant   149 -------KEDTTPIAVVIPGLTSDSSSAYLKHLAYDTAKTGWNVVISNHRG-LGGVSVTSDCFYN 205

  Fly   164 YGHTEDFAAMVEHLHQKYRQSRIVAVGFSLGGNLVTKYMGEDQKTKPDKVIGGISICQGYNAVEG 228
            .|.|:|...::::|..||.::.:.|:|.|:|.|::.||:||:.:..|  :.|.::||..::.:.|
plant   206 AGWTDDIRVVLDYLQHKYPRAPLFAIGTSIGANVLVKYLGEEGEKTP--LRGAVAICSPWDLLIG 268

  Fly   229 TKWLLNWQNFRRFYLYIMTENVKSIILRHRHILLSDEVKARHNLNEREIIAAATLPELDEAYTRR 293
            .:::..... ::.|...:|..::.....|       |.:.....|...|..:.::.:.|...|..
plant   269 DRFICRTLK-QKLYDKALTIGLQGYAQLH-------EPQFLRLANWEGIKKSRSIRDFDNHATCL 325

  Fly   294 VYNFPSTQELYKWSSSLFYFDTIKKPMIFINAKDDPLIPEDLLHPIKEYATTRQNTAYVEVAHGG 358
            |..|.:....|:.|||..|...:..|::.|:|.||||..::.: |..| ....:|.......|||
plant   326 VGKFETVDTYYRKSSSTQYVGNVAVPLLCISALDDPLCTKEAI-PWDE-CRANKNIVLATTNHGG 388

  Fly   359 HLGFYEGGFLYPNPVTWLDRT 379
            ||.|:||  |..:.:.|:..|
plant   389 HLAFFEG--LTGSSLWWVRAT 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hydr2NP_001245852.1 Abhydrolase 51..381 CDD:304388 87/338 (26%)
Abhydrolase_1 115..365 CDD:278959 65/249 (26%)
AT1G34340NP_174694.2 PLN02511 74..395 CDD:215282 85/330 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0429
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10794
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.