DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hydr2 and Abhd15

DIOPT Version :9

Sequence 1:NP_001245852.1 Gene:Hydr2 / 33532 FlyBaseID:FBgn0014906 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001100495.1 Gene:Abhd15 / 303343 RGDID:1304598 Length:459 Species:Rattus norvegicus


Alignment Length:395 Identity:91/395 - (23%)
Similarity:137/395 - (34%) Gaps:111/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SVWCLDAHFLDCLYKIAPVLR-----EPYIPPRLWGFSGHVQTVLHSI--VGRVRCPWPLGERVY 87
            |:.|..:....||.:   .||     ||  .||.|....|:||..|.|  ||    |.|...|.|
  Rat    62 SLICKPSALAQCLLR---ALRRSAALEP--SPRSWLSGPHLQTFCHFILPVG----PDPELAREY 117

  Fly    88 MSLKDGSTLTYDLYQPLNEQEDDITVAIC--------PG--------IANS----SESVYIRTFV 132
            :.|.|...:..|.           .:..|        ||        |.|:    :.:|      
  Rat   118 LQLADDGLVALDW-----------VIGPCARGRRVTNPGSLPPVLLVIPNAWGRLTRNV------ 165

  Fly   133 HLAQC-----NGYRCAVLNHIGALRSVQVTSTRIFTYGHTEDFAAMVEHLHQKYRQSRIVAVGFS 192
             |..|     :|| ..|:.|........:.|.|:..:|...|....|.::..::..:.:.||...
  Rat   166 -LGLCLLALEHGY-YPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEG 228

  Fly   193 LGGNLVTKYMGEDQKTKPDKVIGGISICQGYNAVEGT----KWL---LNWQNFRRFYLYIMTENV 250
            .|..|:..|:||         .|..|...|...:...    :|.   |.|...|.|.||      
  Rat   229 SGSALLLSYLGE---------CGSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLY------ 278

  Fly   251 KSIILRHRHILLSDEVKARHNLNEREIIAAATLPELDEAYTRRVYNFPSTQELYKW--SSSLFYF 313
            :.|.|......|.|.|      :..::..:::|.|.:|.......:.|.:.:.| |  :..|...
  Rat   279 QKIALSRYASALEDTV------DTGKLFKSSSLREFEETLFCHTKSLPISWDTY-WDLNDPLRDV 336

  Fly   314 DTIKKPMIFINAKDDPL-------IPEDLLHPIKEYATTRQNTAYVEVAHGGHLGFYEGGFLYPN 371
            |....|::.|.:.|||:       :|.:|.|       |......:..:||||.     |||.|.
  Rat   337 DEAAVPVLCICSADDPVCGPPDRTLPAELFH-------TNPYFFLLLSSHGGHC-----GFLRPE 389

  Fly   372 PV-TW 375
            |: .|
  Rat   390 PLPAW 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hydr2NP_001245852.1 Abhydrolase 51..381 CDD:304388 85/369 (23%)
Abhydrolase_1 115..365 CDD:278959 60/290 (21%)
Abhd15NP_001100495.1 Abhydrolase 85..410 CDD:304388 85/369 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0429
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53891
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.