DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hydr2 and ABHD15

DIOPT Version :9

Sequence 1:NP_001245852.1 Gene:Hydr2 / 33532 FlyBaseID:FBgn0014906 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_937790.2 Gene:ABHD15 / 116236 HGNCID:26971 Length:468 Species:Homo sapiens


Alignment Length:357 Identity:84/357 - (23%)
Similarity:130/357 - (36%) Gaps:57/357 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SVWCLDAHFLDCLYKIAPVLREPYIPPRLWGFSG-HVQTVLHSIVGRVRCPWPLGERVYMSLKDG 93
            |:.|..:....||.:...........||.| ||| |:||:.|.::  ...|.|...|.|:.|.|.
Human    71 SLVCKPSALAQCLLRALRRSEALEAGPRSW-FSGPHLQTLCHFVL--PVAPGPELAREYLQLADD 132

  Fly    94 STLTYD-LYQPLNEQEDDITVAICPGIANSSESVYIR-TFVHLAQC-----NGYRCAVLNHIGAL 151
            ..:..| :..|........:....|.:.....:.:.| |...|..|     .|| ..|:.|....
Human   133 GLVALDWVVGPCVRGRRITSAGGLPAVLLVIPNAWGRLTRNVLGLCLLALERGY-YPVIFHRRGH 196

  Fly   152 RSVQVTSTRIFTYGHTEDFAAMVEHLHQKYRQSRIVAVGFSLGGNLVTKYMGEDQKTKPDKVIGG 216
            ....:.|.|:..:|...|....|.::..::..:.:.||....|..|:..|:||         .|.
Human   197 HGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGE---------CGS 252

  Fly   217 ISICQGYNAVEGT----KWL---LNWQNFRRFYLYIMTENVKSIILRHRHILLSDEVKA-RHNLN 273
            .|...|...:...    :|.   |.|...|.|.|             |:.|.||....| ...::
Human   253 SSYVTGAACISPVLRCREWFEAGLPWPYERGFLL-------------HQKIALSRYATALEDTVD 304

  Fly   274 EREIIAAATLPELDEAYTRRVYNFPSTQELYKW--SSSLFYFDTIKKPMIFINAKDDPLI-PEDL 335
            ...:..:.:|.|.:||......:||.:.:.| |  :..|...|....|::.|.:.|||:. |.| 
Human   305 TSRLFRSRSLREFEEALFCHTKSFPISWDTY-WDRNDPLRDVDEAAVPVLCICSADDPVCGPPD- 367

  Fly   336 LHPIKEYATTR--QNTAYVEV---AHGGHLGF 362
             |.:    ||.  .:..|..:   .||||.||
Human   368 -HTL----TTELFHSNPYFFLLLSRHGGHCGF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hydr2NP_001245852.1 Abhydrolase 51..381 CDD:304388 80/336 (24%)
Abhydrolase_1 115..365 CDD:278959 62/270 (23%)
ABHD15NP_937790.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..61
Abhydrolase 100..419 CDD:304388 78/328 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0429
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53891
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.