DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mad and SMAD9

DIOPT Version :9

Sequence 1:NP_001259992.1 Gene:Mad / 33529 FlyBaseID:FBgn0011648 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_006719890.1 Gene:SMAD9 / 4093 HGNCID:6774 Length:479 Species:Homo sapiens


Alignment Length:419 Identity:289/419 - (68%)
Similarity:325/419 - (77%) Gaps:32/419 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LGSLFSFTSPAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAIEELERALSCPGQPSKCVTI 151
            :.|||||||||||:|||||||||||||||||||||||||||:|||::||||||||||||||||||
Human     7 ISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTI 71

  Fly   152 PRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLELCQYPFSAKQKEVCINPYHYKRVES 216
            ||||||||||||||||||||||||||||||||||||||||.|::||.:||||||||||||:|||:
Human    72 PRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVET 136

  Fly   217 PVLPPVLVPRHSEFAPGHSML-QFNHV---AEPSMPHNVSYSNSGFN-----------SHSLSTS 266
            |||||||||||||:.|..|:| :|...   :||.||||.:|.:| |.           ||:.|.|
Human   137 PVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS-FQQPPCSALPPSPSHAFSQS 200

  Fly   267 NTSVGSPSSVN--SNPNSPYDSLAGTPPPAYSPSEDGNSNNPNDGGQLLDAQM----------GD 319
            ..:...|.|..  |.|.|||.....|||..|..:|...:.:    ||.:||..          ||
Human   201 PCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQS----GQPVDATADRHVVLSIPNGD 261

  Fly   320 VAQVSYSEPAFWASIAYYELNCRVGEVFHCNNNSVIVDGFTNPSNNSDRCCLGQLSNVNRNSTIE 384
            ...|.|.||..|.|:||||||.||||.|..::.||::||||:||||.:|.|||.|||||||||||
Human   262 FRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIE 326

  Fly   385 NTRRHIGKGVHLYYVTGEVYAECLSDSAIFVQSRNCNYHHGFHPSTVCKIPPGCSLKIFNNQEFA 449
            |||||||||||||||.|||||||:|||:||||||||||.|||||:||||||.|||||:||||.||
Human   327 NTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFA 391

  Fly   450 QLLSQSVNNGFEAVYELTKMCTIRMSFVK 478
            |||:|||::|||.||||||||||||||||
Human   392 QLLAQSVHHGFEVVYELTKMCTIRMSFVK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MadNP_001259992.1 MH1_SMAD_1_5_9 93..216 CDD:199814 112/122 (92%)
MH2_SMAD_1_5_9 325..525 CDD:199822 123/154 (80%)
SMAD9XP_006719890.1 MH1_SMAD_1_5_9 13..136 CDD:199814 112/122 (92%)
MH2 267..>420 CDD:294046 121/152 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159947
Domainoid 1 1.000 326 1.000 Domainoid score I1183
eggNOG 1 0.900 - - E1_KOG3701
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 704 1.000 Inparanoid score I667
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48637
OrthoDB 1 1.010 - - D274383at33208
OrthoFinder 1 1.000 - - FOG0000630
OrthoInspector 1 1.000 - - otm40519
orthoMCL 1 0.900 - - OOG6_103959
Panther 1 1.100 - - O PTHR13703
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2797
SonicParanoid 1 1.000 - - X373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.