DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mad and gei-4

DIOPT Version :9

Sequence 1:NP_001259992.1 Gene:Mad / 33529 FlyBaseID:FBgn0011648 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_497190.1 Gene:gei-4 / 175195 WormBaseID:WBGene00001561 Length:568 Species:Caenorhabditis elegans


Alignment Length:172 Identity:38/172 - (22%)
Similarity:63/172 - (36%) Gaps:56/172 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 HSMLQFNHVA-EPSMPHNVSYSNSGFNSHSLSTSNTSVGSPSSVNSNPN-------------SPY 284
            |.:.||...: :|:     :||||  |:::..:||::...|:||...|.             ..|
 Worm    24 HGISQFQQNSYQPT-----TYSNS--NANNFHSSNSATFIPNSVTQTPQRRMGEEKSLVNMLDAY 81

  Fly   285 DSLAGTPPPAYSPSEDGNSNNPNDGGQLLDAQMGDVAQVSYSEPAFWASIAYYEL---NCRVGEV 346
            ...:.||    |.|...|:..|        .||..:.|          |:..|..   ..:||:|
 Worm    82 FIDSTTP----STSTSWNNQQP--------VQMSSIQQ----------SVGSYNQQIPQLKVGDV 124

  Fly   347 FHCNNNSVIVDGF-TNPSNNSDRCCLGQLSNVNRNSTIENTR 387
                  .:.|:|. ...|::.|:   |:...|.:....|..|
 Worm   125 ------DLQVEGMNVKLSSSPDK---GEKDRVKKARQAEAAR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MadNP_001259992.1 MH1_SMAD_1_5_9 93..216 CDD:199814
MH2_SMAD_1_5_9 325..525 CDD:199822 13/67 (19%)
gei-4NP_497190.1 PTZ00121 <133..410 CDD:173412 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S660
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.