DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5B and Ndufc2

DIOPT Version :9

Sequence 1:NP_001259991.1 Gene:ND-B14.5B / 33528 FlyBaseID:FBgn0031505 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_077182.1 Gene:Ndufc2 / 68197 MGIID:1344370 Length:120 Species:Mus musculus


Alignment Length:117 Identity:42/117 - (35%)
Similarity:63/117 - (53%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NDPLELLTNKGTHEPSFLSPIWNP---IACGVAGVGAAIFINWGFRKPVF-SGIQKHIAFGAIGV 65
            ::||:.|.::....|   .|..|.   :..|:.|....:..|....:||. :|:.:.:.|....|
Mouse     8 HEPLKFLPDEARSLP---PPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFV 69

  Fly    66 GAGAYFDQKRNEYL-AKRDAVLRHYIELHPDDFPVKERKTYGQVLESWVPVR 116
            .|| ||..||..|| |.:|..:..||:|||:|||.||:|||.::||.:.|||
Mouse    70 FAG-YFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5BNP_001259991.1 NDUF_C2 5..116 CDD:283922 40/115 (35%)
Ndufc2NP_077182.1 NDUF_C2 11..120 CDD:399399 39/112 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850457
Domainoid 1 1.000 59 1.000 Domainoid score I10692
eggNOG 1 0.900 - - E1_KOG4516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5414
Isobase 1 0.950 - 0 Normalized mean entropy S7318
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006230
OrthoInspector 1 1.000 - - oto94297
orthoMCL 1 0.900 - - OOG6_109196
Panther 1 1.100 - - LDO PTHR13099
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5592
SonicParanoid 1 1.000 - - X5174
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.