DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5B and ndufc2

DIOPT Version :9

Sequence 1:NP_001259991.1 Gene:ND-B14.5B / 33528 FlyBaseID:FBgn0031505 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001013535.1 Gene:ndufc2 / 541390 ZFINID:ZDB-GENE-050320-87 Length:110 Species:Danio rerio


Alignment Length:104 Identity:29/104 - (27%)
Similarity:50/104 - (48%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KGTHEPSFLSPIWNPIACGVAGVGAAIFINWGFRKPVF-SGIQKHIAFGAIGVGAGAYFDQKRNE 77
            ||...|..::.  |.:..|:.|...|:..|...|:|.. :|:.:.:....||...|.:..:....
Zfish     9 KGLPPPGIVNR--NSVWLGLLGWANAVLHNSVNRRPALKAGVHRQVLCITIGWFIGYHLTKYEKF 71

  Fly    78 YLAKRDAVLRHYIELHPDDFPVKERKTYGQVLESWVPVR 116
            ..||.|..:..||..||::|..|||||:.:::|.:..:|
Zfish    72 KYAKLDRDMSEYIRHHPNEFEQKERKTFAEIVEPFHAIR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5BNP_001259991.1 NDUF_C2 5..116 CDD:283922 28/102 (27%)
ndufc2NP_001013535.1 NDUF_C2 4..110 CDD:283922 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596399
Domainoid 1 1.000 45 1.000 Domainoid score I12211
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5481
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606491at2759
OrthoFinder 1 1.000 - - FOG0006230
OrthoInspector 1 1.000 - - oto39751
orthoMCL 1 0.900 - - OOG6_109196
Panther 1 1.100 - - LDO PTHR13099
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5174
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.