DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5B and NDUFC2

DIOPT Version :9

Sequence 1:NP_001259991.1 Gene:ND-B14.5B / 33528 FlyBaseID:FBgn0031505 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_004540.1 Gene:NDUFC2 / 4718 HGNCID:7706 Length:119 Species:Homo sapiens


Alignment Length:115 Identity:35/115 - (30%)
Similarity:61/115 - (53%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPLELLTN--KGTHEPSFLSPIWNPIACGVAGVGAAIFINWGFRKPV-FSGIQKHIAFGAIGVGA 67
            :||..|.:  :....|....|  ..:..|..|..:.:..|...|:|: .:|:.:.:.:......|
Human     8 EPLRFLPDEARSLPPPKLTDP--RLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFA 70

  Fly    68 GAYFDQKRNEYL-AKRDAVLRHYIELHPDDFPVKERKTYGQVLESWVPVR 116
            | |:..||.:|| |.||..:..|::|||:|||.:::||||::.|.:.|:|
Human    71 G-YYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5BNP_001259991.1 NDUF_C2 5..116 CDD:283922 34/113 (30%)
NDUFC2NP_004540.1 NDUF_C2 10..119 CDD:399399 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160088
Domainoid 1 1.000 54 1.000 Domainoid score I11232
eggNOG 1 0.900 - - E1_KOG4516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5440
Isobase 1 0.950 - 0 Normalized mean entropy S7318
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606491at2759
OrthoFinder 1 1.000 - - FOG0006230
OrthoInspector 1 1.000 - - oto90710
orthoMCL 1 0.900 - - OOG6_109196
Panther 1 1.100 - - LDO PTHR13099
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5592
SonicParanoid 1 1.000 - - X5174
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.740

Return to query results.
Submit another query.