DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5B and Ndufc2

DIOPT Version :9

Sequence 1:NP_001259991.1 Gene:ND-B14.5B / 33528 FlyBaseID:FBgn0031505 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001009290.1 Gene:Ndufc2 / 293130 RGDID:1307511 Length:120 Species:Rattus norvegicus


Alignment Length:117 Identity:41/117 - (35%)
Similarity:60/117 - (51%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NDPLELLTNKGTHEPSFLSPIWNP---IACGVAGVGAAIFINWGFRKPVF-SGIQKHIAFGAIGV 65
            ::||..|.::....|   .|..|.   :..|..|....:..|....:||. :|:.:.:.:.....
  Rat     8 HEPLRFLPDEARRLP---PPKLNDPRLVYIGFLGYCTGLMDNMMRMRPVMKAGLHRQLLYVTSFF 69

  Fly    66 GAGAYFDQKRNEYL-AKRDAVLRHYIELHPDDFPVKERKTYGQVLESWVPVR 116
            .|| ||..||..|| |.||..:..||:|||:|||.||:|||.::||.:.|||
  Rat    70 FAG-YFYLKRQNYLYAVRDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5BNP_001259991.1 NDUF_C2 5..116 CDD:283922 39/115 (34%)
Ndufc2NP_001009290.1 NDUF_C2 11..120 CDD:399399 38/112 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354155
Domainoid 1 1.000 56 1.000 Domainoid score I10757
eggNOG 1 0.900 - - E1_KOG4516
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5328
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606491at2759
OrthoFinder 1 1.000 - - FOG0006230
OrthoInspector 1 1.000 - - oto97815
orthoMCL 1 0.900 - - OOG6_109196
Panther 1 1.100 - - LDO PTHR13099
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5174
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.