DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B14.5B and ndufc2

DIOPT Version :9

Sequence 1:NP_001259991.1 Gene:ND-B14.5B / 33528 FlyBaseID:FBgn0031505 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_002943399.1 Gene:ndufc2 / 100488920 XenbaseID:XB-GENE-979881 Length:110 Species:Xenopus tropicalis


Alignment Length:91 Identity:32/91 - (35%)
Similarity:44/91 - (48%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NPIACGVAGVGAAIFINWGFRKPVF-SGIQKHIAFGAIGVGAGAYFDQKRNEYLAKRDAVLRHYI 90
            |.:..|:.|...||..|.....|.. :|:.:.:...:|||..|.:..:..|...|..|..|..||
 Frog    20 NSVWMGLMGYLTAITHNAIRHMPALRAGVHRQLLLTSIGVFLGYHATKYENYRNANTDRQLFEYI 84

  Fly    91 ELHPDDFPVKERKTYGQVLESWVPVR 116
            ..||.||.|.||||..:|||.:.|:|
 Frog    85 RQHPQDFKVPERKTMAEVLEEFTPIR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B14.5BNP_001259991.1 NDUF_C2 5..116 CDD:283922 31/89 (35%)
ndufc2XP_002943399.1 NDUF_C2 1..110 CDD:368866 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11301
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1606491at2759
OrthoFinder 1 1.000 - - FOG0006230
OrthoInspector 1 1.000 - - oto104503
Panther 1 1.100 - - LDO PTHR13099
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5174
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.