DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and AT2G20940

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001324017.1 Gene:AT2G20940 / 816628 AraportID:AT2G20940 Length:129 Species:Arabidopsis thaliana


Alignment Length:123 Identity:32/123 - (26%)
Similarity:54/123 - (43%) Gaps:25/123 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGM------------------ 145
            :||...|:||...:..|..:|.:|:.|||..:.:.:::..:||.:.:                  
plant     4 RLKEIVKKYGKVALGVHFSVSGVSISGFYIAIKNNVDVESLLEKYQIPWFSSKENPNPSLDLKLE 68

  Fly   146 --GSSAVAEKV-----AAGSTFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGLLK 196
              ||.....|.     :||....:|...:|...|.|:.||:..||.|.|:||.:.:||
plant    69 EQGSVTSDNKTKQLAKSAGGALALAVLCNKALFPIRVPITMALTPPIARFLRQRKILK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 25/109 (23%)
AT2G20940NP_001324017.1 DUF1279 3..114 CDD:369134 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1506373at2759
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - oto4248
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - O PTHR21377
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.