DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and Fam210b

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_080188.3 Gene:Fam210b / 67017 MGIID:1914267 Length:190 Species:Mus musculus


Alignment Length:136 Identity:68/136 - (50%)
Similarity:91/136 - (66%) Gaps:4/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TKHGGCFKQ---NYSTESASTGTATTLKITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALV 130
            |..|.|..:   |.:.|...:.|.|..|:::.:|||:.|:||||..|..|:.||::|||.||.:|
Mouse    53 TARGDCLSRQEPNRTPEPGGSVTGTEKKLSRTQQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVV 117

  Fly   131 SSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGL 194
            ||||::..:|...|...|.|..|:||| ||||||:|:||:|||.||||||.:.||:|||.||.||
Mouse   118 SSGIDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPFVVRYFRSVGL 182

  Fly   195 LKPKST 200
            .||.:|
Mouse   183 FKPPAT 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 48/86 (56%)
Fam210bNP_080188.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..81 6/24 (25%)
DUF1279 85..172 CDD:369134 48/86 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842615
Domainoid 1 1.000 97 1.000 Domainoid score I7229
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - otm43022
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - LDO PTHR21377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4368
SonicParanoid 1 1.000 - - X4449
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.