DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and fam210b

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001028923.1 Gene:fam210b / 619270 ZFINID:ZDB-GENE-050913-122 Length:223 Species:Danio rerio


Alignment Length:164 Identity:63/164 - (38%)
Similarity:100/164 - (60%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ALMQNYISGTRKPISIREKREYKYSSQDMNWTKHGGCFKQNYSTESASTGTATTLKITKREQLKR 102
            ::..:::...|:.::..||.|   .:.|:          ::....||:.|  :.||.:|.:||::
Zfish    73 SVRSSFVMQPRRSLTTPEKHE---RAADI----------RSDGVSSAADG--SELKASKVQQLRQ 122

  Fly   103 AFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSAVAEKVAAG-STFVVAFAV 166
            .|::|||..|.||:.||:||||.||..||||:::..:|...|...:.|..::||| |.||:|:||
Zfish   123 VFQQYGAVGVSFHICISLISLGIFYLAVSSGLDVASLLCKLGFSEAVVQSRLAAGTSVFVLAYAV 187

  Fly   167 HKIFAPARISITLGTTPFIVRYLRSKGLLKPKST 200
            ||:|||.||||||...|.|||:||..||.:.:::
Zfish   188 HKLFAPLRISITLVCVPLIVRHLRRTGLFRSRTS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 44/86 (51%)
fam210bNP_001028923.1 DUF1279 118..205 CDD:284361 44/86 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587030
Domainoid 1 1.000 86 1.000 Domainoid score I8052
eggNOG 1 0.900 - - E1_KOG4526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4905
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004761
OrthoInspector 1 1.000 - - otm24340
orthoMCL 1 0.900 - - OOG6_103781
Panther 1 1.100 - - LDO PTHR21377
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4368
SonicParanoid 1 1.000 - - X4449
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.