DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and Y56A3A.22

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_499555.1 Gene:Y56A3A.22 / 176627 WormBaseID:WBGene00013239 Length:263 Species:Caenorhabditis elegans


Alignment Length:185 Identity:46/185 - (24%)
Similarity:66/185 - (35%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QLKTMSPVHLFHSTALMQNYISGTRKPISIREKREYKYSSQDMNWTKHGGCFKQNYSTESASTGT 88
            |.:|.|.....|::.             .:.||........|..|.    .|:...|.|.....|
 Worm    18 QFQTPSSSRFLHTSR-------------QLHEKEPTPKKPDDQKWK----MFRMTMSEEQKLAKT 65

  Fly    89 ATTLKITKRE-------QLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMG 146
            |...::...|       ::|..||.|....|..|...........|.:|.||::::.:||:..| 
 Worm    66 AKIEQMKAEEAPKTLFAKVKYYFKRYWYIAVPAHAASCTAWFIALYLVVKSGVDVISLLEWLHM- 129

  Fly   147 SSAVAEKV-----AAGSTFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGLLK 196
            ..|:.|||     .|| ..||:..::||..|.|...||.........||..|.||
 Worm   130 PDAIVEKVKNTPETAG-VVVVSLILYKIAMPFRYMTTLLLIQATFWTLRRLGKLK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 28/97 (29%)
Y56A3A.22NP_499555.1 DUF1279 82..170 CDD:369134 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4368
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.