DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and Fam210a

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_722489.1 Gene:Fam210a / 108654 MGIID:1914000 Length:273 Species:Mus musculus


Alignment Length:131 Identity:44/131 - (33%)
Similarity:69/131 - (52%) Gaps:11/131 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KQNYSTESASTGTATTLK----------ITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALV 130
            |:..|:.|.|..|.:..|          |:..::.|:.|::||..::..|::.|.|..|.||...
Mouse    93 KRVLSSSSTSQETPSEKKEETDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGIWFGTFYYAT 157

  Fly   131 SSGINLVPVLEYFGMGSSAV-AEKVAAGSTFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGL 194
            ..|:|::|.||..|:..|.| ..|.:.....:.|:|:.||..|||.::|||.|.|.|:||||.|.
Mouse   158 IKGVNVIPFLEVIGLPDSIVDILKNSQSGNALTAYAMFKIATPARYTVTLGGTSFTVKYLRSHGY 222

  Fly   195 L 195
            :
Mouse   223 M 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 30/86 (35%)
Fam210aNP_722489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 5/21 (24%)
DUF1279 125..212 CDD:369134 30/86 (35%)
Kri1 230..>270 CDD:368319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4368
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.