DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15403 and fam210a

DIOPT Version :9

Sequence 1:NP_608749.2 Gene:CG15403 / 33527 FlyBaseID:FBgn0031504 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001096481.1 Gene:fam210a / 100125103 XenbaseID:XB-GENE-944382 Length:274 Species:Xenopus tropicalis


Alignment Length:171 Identity:52/171 - (30%)
Similarity:80/171 - (46%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HSTALMQNYISGTRKPI------SIREKREYKYSSQDMNWTKHGGCFKQNYSTES---ASTGTAT 90
            ||....|:  |.|:.|:      |..:..|...|:            |.:.||::   |.|....
 Frog    54 HSQPKQQD--SSTKTPVHDLPSGSQHQSEESSPSA------------KSSISTDTSIVAETDPLQ 104

  Fly    91 TLKITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSAV-AEKV 154
            ...|...::.|:.||::|..::..|:|.|....|.||.....|:|:||.||:.|:....| ..|.
 Frog   105 DQSIGLLKRFKKTFKQHGKVLIPVHLVTSSFWFGSFYYAAMKGVNVVPFLEFIGLPDVIVNILKN 169

  Fly   155 AAGSTFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGLL 195
            :.|...:.|:|::||..|||.::|||.|...|:|||..|.|
 Frog   170 SQGGNALTAYAMYKIATPARYTVTLGGTSLSVKYLRKYGYL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15403NP_608749.2 DUF1279 98..184 CDD:284361 31/86 (36%)
fam210aNP_001096481.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..91 10/50 (20%)
DUF1279 113..199 CDD:369134 31/85 (36%)
LEA_4 217..260 CDD:111833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4368
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.