DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toc and ccdc69

DIOPT Version :9

Sequence 1:NP_477153.1 Gene:toc / 33526 FlyBaseID:FBgn0015600 Length:2162 Species:Drosophila melanogaster
Sequence 2:XP_021336837.1 Gene:ccdc69 / 794166 ZFINID:ZDB-GENE-120720-3 Length:314 Species:Danio rerio


Alignment Length:340 Identity:69/340 - (20%)
Similarity:136/340 - (40%) Gaps:87/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1560 HTQKDCERLREDLEDKGLEWIQRQQEKEYLHRTELKQAEEKLMEVQLR-------AKLKFCELES 1617
            |..|.|.:            :.::::|     .:.::.|:...:::|:       ::.:.|.||:
Zfish     4 HNSKVCGQ------------VSKKKKK-----NKAQEGEKHTKDIKLQDGSGTHSSEEERCCLEN 51

  Fly  1618 QLR---------------AKDEESKQ---------------AQEAYRMEVSHKL-ALKQEHLRTA 1651
            ||.               :.|:|.:|               ..|..:.|:|..| .|.::.:|:.
Zfish    52 QLENYEWQLKILHAVLTASGDQEREQLLKDHPGDICTLVHSITEKVKTEISADLNDLHEQQMRSV 116

  Fly  1652 EQKIQELQTRLQQVETEEQGHREELIRKENIHTARLAEANQREQDLIDRVKSLTKELNTLKANKE 1716
            .::.|.....||::.:||          :|:.....|.|   |:.|.|:::.||.||      |.
Zfish   117 SEQHQSETEELQRLHSEE----------KNVLNESYAAA---EEALKDQIEDLTSEL------KL 162

  Fly  1717 HNERDLRDRLALSQDEISVLRTSSQRRSPCTSLPDNASAELNRLTSEADSLRCVLELKQAEISAL 1781
            .||  |:.|.     |.|.|:...||.......|.....:      |.:||..|:|:|:..:...
Zfish   163 FNE--LKRRA-----EASTLKRDLQRNIETHGSPGEFWEQ------EQESLLFVIEMKRQNLQDQ 214

  Fly  1782 SKAKADLIHESEERLKLSNRVALLEAQNEMLRTELEAKTEKEKEIQQKMEELQKAYKYESIKRTR 1846
            ......:....|:.|.|.:::.....|||..|..:|......:::.::..::|:..:.:|::..:
Zfish   215 GNKLLQMEALVEKNLSLEDQLLQALQQNEDFRVRIENYQSLIQQLSKEQNDMQEVLEKQSLQNQK 279

  Fly  1847 LTYDKEELQYHLKQR 1861
            |..:||||.:.|..|
Zfish   280 LIQEKEELLFKLLHR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tocNP_477153.1 DUF390 <1302..1737 CDD:282014 42/214 (20%)
RILP-like <1550..1668 CDD:304877 23/145 (16%)
COG1340 1580..1850 CDD:224259 60/307 (20%)
YlqD 1642..>1712 CDD:287979 17/69 (25%)
DUF4795 1652..1826 CDD:292662 40/173 (23%)
ccdc69XP_021336837.1 SMC_N <49..291 CDD:330553 60/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24200
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.