DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment toc and CCDC69

DIOPT Version :9

Sequence 1:NP_477153.1 Gene:toc / 33526 FlyBaseID:FBgn0015600 Length:2162 Species:Drosophila melanogaster
Sequence 2:NP_056436.2 Gene:CCDC69 / 26112 HGNCID:24487 Length:296 Species:Homo sapiens


Alignment Length:322 Identity:69/322 - (21%)
Similarity:122/322 - (37%) Gaps:86/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1542 HQCARTKGTLEKTILL-----LQHTQKDCERLREDLEDKGLEWIQRQQEKEYLHRTELKQAEEKL 1601
            |:.....|....|:.|     .:..|||..|:.:..|::..:|.| |.|||              
Human    32 HELGPLNGDTAITVQLCASEEAERHQKDITRILQQHEEEKKKWAQ-QVEKE-------------- 81

  Fly  1602 MEVQLRAKLKFCELESQLRAKDEESKQAQEAYRMEVSHKLALKQEHLRTAEQKIQELQTRLQQVE 1666
            .|::||.:|.  |.:..|..|:||:.|.                  ||.:.::.:|..|      
Human    82 RELELRDRLD--EQQRVLEGKNEEALQV------------------LRASYEQEKEALT------ 120

  Fly  1667 TEEQGHREELIRKENIHTARLAEANQREQDLIDRVKSLTKELNTLKANKEHNERDLRDRLALSQD 1731
                            |:.|  ||:..:|:.|||   ||.:|...:|.             :.:.
Human   121 ----------------HSFR--EASSTQQETIDR---LTSQLEAFQAK-------------MKRV 151

  Fly  1732 EISVLRTSSQRRSPCTSLPDNASAELNRLTSEADSLRCVLELKQAEISALSKAKADLIHESEERL 1796
            |.|:|..:.::.......|.....:      |.:||..|:|:|...|..|.:....:....|:.|
Human   152 EESILSRNYKKHIQDYGSPSQFWEQ------ELESLHFVIEMKNERIHELDRRLILMETVKEKNL 210

  Fly  1797 KLSNRVALLEAQNEMLRTELEAKTEKEKEIQQKMEELQKAYKYESIKRTRLTYDKEELQYHL 1858
            .|..::..|:.:||.|......:....:::.:.:...::|.:.|...|.:|..:||||.|.:
Human   211 ILEEKITTLQQENEDLHVRSRNQVVLSRQLSEDLLLTREALEKEVQLRRQLQQEKEELLYRV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tocNP_477153.1 DUF390 <1302..1737 CDD:282014 43/199 (22%)
RILP-like <1550..1668 CDD:304877 27/122 (22%)
COG1340 1580..1850 CDD:224259 54/269 (20%)
YlqD 1642..>1712 CDD:287979 15/69 (22%)
DUF4795 1652..1826 CDD:292662 33/173 (19%)
CCDC69NP_056436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 2/8 (25%)
SMC_prok_B 51..>270 CDD:274008 64/299 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24200
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.