DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN1 and NQR

DIOPT Version :10

Sequence 1:NP_001137778.2 Gene:FASN1 / 33524 FlyBaseID:FBgn0283427 Length:2540 Species:Drosophila melanogaster
Sequence 2:NP_001185182.1 Gene:NQR / 841391 AraportID:AT1G49670 Length:652 Species:Arabidopsis thaliana


Alignment Length:227 Identity:43/227 - (18%)
Similarity:73/227 - (32%) Gaps:78/227 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 LAVAEVRAARRARQPEFDRSFVAAIADEKARILRIRGPALLEDITDFVRAWFREWYDETLAFDLI 375
            |.:.:.:|....|:.:|| ..|..:||...     .||.        .:.:.:.:|...|...|.
plant   157 LVIKDAKAELEKREEKFD-IIVGDLADPVE-----GGPC--------YQLYTKSFYQNILKPKLS 207

  Fly   376 PEPF---QGGTV-LIVRGETLTPLEYLALERQKQLDKLKTPEQKKKEADAMKA------------ 424
            |...   |.|.. :....|..|.:             ..|.:|..|...|..|            
plant   208 PNGIFVTQAGPAGIFTHKEVFTSI-------------YNTMKQVFKYVKAYTAHVPSFADTWGWV 259

  Fly   425 -AKEREQEKKREEKARLKELAREKRARERKEGKTYDFTEPEFMTNAYLTLEETLARYRKDWAFVN 488
             |.:.|.:.:.:|        .::|..||..|:......|.|::.|  ||.:|::          
plant   260 MASDHEFDVEVDE--------MDRRIEERVNGELMYLNAPSFVSAA--TLNKTIS---------- 304

  Fly   489 ELDNLQDLPIMEWITLDKFAEVHQELHAE-VH 519
                         :.|:|..||:.|.:|. :|
plant   305 -------------LALEKETEVYSEENARFIH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN1NP_001137778.2 PksD 139..>950 CDD:442550 43/227 (19%)
hot_dog 990..1193 CDD:469797
Rossmann-fold NAD(P)(+)-binding proteins 1358..>1550 CDD:473865
PKS_ER 1593..1883 CDD:214840
KR_1_FAS_SDR_x <1901..2141 CDD:187657
PKS_PP 2154..>2206 CDD:214834
EntF2 <2284..2540 CDD:442548
NQRNP_001185182.1 ADH_SDR_c_like 9..254 CDD:187584 23/123 (19%)
Mgc45594_like 286..640 CDD:176212 13/63 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.