DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN1 and AT4G21580

DIOPT Version :9

Sequence 1:NP_001137778.2 Gene:FASN1 / 33524 FlyBaseID:FBgn0283427 Length:2540 Species:Drosophila melanogaster
Sequence 2:NP_193889.1 Gene:AT4G21580 / 828243 AraportID:AT4G21580 Length:325 Species:Arabidopsis thaliana


Alignment Length:339 Identity:91/339 - (26%)
Similarity:139/339 - (41%) Gaps:58/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1565 VKGDLASLKWIEAA--QADTAATVDKNLETCTVYYAPINFRDVMLTSGKLAADALPGDLAEQDCV 1627
            ||.|...::.:..|  :|||       |:...:|..|                  ||    ....
plant    25 VKDDEVLIRVLATALNRADT-------LQRLGLYNPP------------------PG----SSPY 60

  Fly  1628 LGLEFAG----------RDTQGRRVMAMVPAKSLATTCVASKRMMWQIPEKWTMEEASTVPCVYS 1682
            ||||.:|          |...|.:|.|::.....|.........::.||...::::|:..|.|..
plant    61 LGLECSGTIESVGKGVSRWKVGDQVCALLSGGGYAEKVSVPAGQIFPIPAGISLKDAAAFPEVAC 125

  Fly  1683 TVYYALVVRGQMKKGEKILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLQER 1747
            ||:..:.:.|::..||..|||.||.|:|..||.:|...|:.||.|.||.||    |....:|...
plant   126 TVWSTVFMMGRLSVGESFLIHGGSSGIGTFAIQIAKHLGVRVFVTAGSDEK----LAACKELGAD 186

  Fly  1748 NIGNSRDTSFEQLVLRETKGRGVDLVLNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSPLGMS 1812
            ...|.:...|...|..||.|:|||::|:.:....||.::..|..:||...||... ..|:.:.:|
plant   187 VCINYKTEDFVAKVKAETDGKGVDVILDCIGAPYLQKNLDSLNFDGRLCIIGLMG-GANAEIKLS 250

  Fly  1813 VFL--KNTSFHGILLDSVMEGEEEMQNQVVSLVAEGIKTGAVVP-----LPTSVFNDQQVEQAFR 1870
            ..|  :.|.....|.....|.:..:..:|...|...|:.|.|.|     ||.|     |..:...
plant   251 SLLPKRLTVLGAALRPRSPENKAVVVREVEKNVWPAIEAGKVKPVIYKYLPLS-----QAAEGHS 310

  Fly  1871 FMASGKHIGKVVIK 1884
            .|.|..||||::::
plant   311 LMESSNHIGKILLE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN1NP_001137778.2 PksD 137..1142 CDD:225858
PKS 140..544 CDD:238429
KAsynt_C_assoc 502..612 CDD:292814
Acyl_transf_1 633..950 CDD:298668
hot_dog 990..1234 CDD:294345
NADB_Rossmann 1358..>1550 CDD:304358
PKS_ER 1593..1883 CDD:214840 83/306 (27%)
enoyl_red 1595..1883 CDD:176179 83/304 (27%)
KR_1_FAS_SDR_x <1901..2141 CDD:187657
PKS_PP 2154..>2206 CDD:214834
Abhydrolase 2286..2535 CDD:304388
AT4G21580NP_193889.1 p53_inducible_oxidoreductase 1..323 CDD:176180 91/336 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4520
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1090
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.