DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN1 and CG12170

DIOPT Version :9

Sequence 1:NP_001137778.2 Gene:FASN1 / 33524 FlyBaseID:FBgn0283427 Length:2540 Species:Drosophila melanogaster
Sequence 2:NP_649565.1 Gene:CG12170 / 40692 FlyBaseID:FBgn0037356 Length:438 Species:Drosophila melanogaster


Alignment Length:414 Identity:108/414 - (26%)
Similarity:173/414 - (41%) Gaps:55/414 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NDDPRRWERGL-------------YGLPDRIGKLKDSDLENFDQQFFGVHQKQAECMDPLLRMLL 223
            |:.|..|.|.|             .|||.::......:....||.   :.:...:.|.|..::.:
  Fly    39 NNGPDSWRRILAGESAISRLSAEFKGLPCQVAAQIPRENLQLDQH---LTKSDIKLMSPATQLAV 100

  Fly   224 ELTHEAIIDAGLNPSDLRG---SRTGVYIGVSN---SETEQHWCS---DADRVNGYGLTGCARAM 279
            ....||:....|.|..|..   .|.||.:|:..   :|....|..   ..:||:.:.:.....:|
  Fly   101 LAAEEALSTGKLCPKQLSEEELERFGVCVGMGMFDLAEVYGAWNQLQRGYNRVSPFFVPRLLPSM 165

  Fly   280 FANRISFTFDFKGPSYSIDTACSSSLYALEQAFSDMREGKVDNALVAGAG-LILKPTMSLQFKRL 343
            ....||.....:||::|:.|||::..:||..|...:|.|..| .::||:| ..:.|.....|.||
  Fly   166 ACGHISMRHGLRGPNHSVSTACATGAHALGDAMRFIRSGDAD-LMLAGSGEACIDPLSIAGFCRL 229

  Fly   344 NMLS------PDGSCKAFDESGNGYVRSDGCVVLLLQRTSAARR----VYASILNVRTNTDGFKE 398
            ..||      |..:.:.||:|.:|:|..:|..||||:....||.    :.|.||....:.|.:. 
  Fly   230 RALSTAFNDNPAVASRPFDKSRDGFVMGEGAAVLLLEELEHARARGAPILAEILGYGLSGDAYH- 293

  Fly   399 QGITYPI--GKMQNRLIRETYEEIGLNPADVVYVEAHGTGTKVGDPQEVNSITDFFCKDRTTPLL 461
              ||.|.  |......::...::.|:.|.||.||.||.|.|..||..|.::|...| ...|..:.
  Fly   294 --ITSPSDDGAGATLAMKRAIQDAGIAPEDVTYVNAHATSTPTGDRIESHAIGRVF-GAHTPQVR 355

  Fly   462 IGSVKSNMGHSEPASGVCSVAKILIAMEEGVIPGNLHYNKPNPDLYGLVDGRLKVVDRNLPWNGG 526
            :.|.|...||...:||......:::|.....:|.:::...        :|..:.||.:...|:..
  Fly   356 VSSTKGAHGHLLGSSGNLEALFVVLACANNKLPPSINIEH--------LDVDVNVVTKATDWSAD 412

  Fly   527 ----IIGLNSFGFGGANAHVILKS 546
                :...|||||||.||.:.:.|
  Fly   413 QKRRVALKNSFGFGGTNASLCIAS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN1NP_001137778.2 PksD 137..1142 CDD:225858 108/414 (26%)
PKS 140..544 CDD:238429 107/410 (26%)
KAsynt_C_assoc 502..612 CDD:292814 14/49 (29%)
Acyl_transf_1 633..950 CDD:298668
hot_dog 990..1234 CDD:294345
NADB_Rossmann 1358..>1550 CDD:304358
PKS_ER 1593..1883 CDD:214840
enoyl_red 1595..1883 CDD:176179
KR_1_FAS_SDR_x <1901..2141 CDD:187657
PKS_PP 2154..>2206 CDD:214834
Abhydrolase 2286..2535 CDD:304388
CG12170NP_649565.1 PRK07314 23..437 CDD:235987 108/414 (26%)
KAS_I_II 24..434 CDD:238430 107/410 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.