DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN1 and SPBC16A3.02c

DIOPT Version :9

Sequence 1:NP_001137778.2 Gene:FASN1 / 33524 FlyBaseID:FBgn0283427 Length:2540 Species:Drosophila melanogaster
Sequence 2:NP_596787.1 Gene:SPBC16A3.02c / 2540039 PomBaseID:SPBC16A3.02c Length:347 Species:Schizosaccharomyces pombe


Alignment Length:339 Identity:82/339 - (24%)
Similarity:141/339 - (41%) Gaps:79/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1587 DKNLETCTVYYAPINFRDVMLTSGKLAADA---LPGDLAEQDCVLGLEFAGR------------D 1636
            |..:|.......|::::  ::.:.::.|.|   ||.       :.|.:||||            .
pombe    45 DVLVEVVATSINPLDYK--LMNTYQMIAKALFKLPN-------IPGYDFAGRVLAVGSEVKEFSA 100

  Fly  1637 TQ-----------GRRVMAMVPAKSLATTCVASKRMMWQIPEKWTMEEASTVPCVYSTVYYALVV 1690
            ||           ||:      ..|.||..|...:.:|.:|:..:..|.:.......|.:..||.
pombe   101 TQRVWGCQSFPRAGRQ------GGSCATHIVTGDKDVWHLPDGVSFNEGAGFGIAGLTAWEVLVR 159

  Fly  1691 RGQMKKGEKILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIG--NSR 1753
            :.::|.|.|::|...|||||..|:::|.|....| ||:.|.|..:..         :::|  ::.
pombe   160 QMKVKPGTKLVIEGASGGVGTFAVALAKALECEV-TTISSTENLDLC---------KSLGATHTL 214

  Fly  1754 DTSFEQLVLRETKGRGVDLVLNSLSEEKL-QASIRCLGLNGRFLEI-GKFDLS----------NN 1806
            |...:.||.|.......|.|.:.:::..| :||.:.:..:|.|..| |...||          ..
pombe   215 DYKKDNLVERLADLGPYDFVFDCVNDNVLYRASSKFVKPDGAFFGIGGDITLSYVGSRLSRTLRP 279

  Fly  1807 SPLGMSVFLKNTSFHGILLDSVMEGEEEMQNQVVSLVAE-GIKTGAVVPLPTSVFNDQQVEQAFR 1870
            ..||.|    :.|::.|||    ..::||....|..|.: .|||     :..||::.:...:||.
pombe   280 RVLGGS----SHSYYNILL----HVDQEMLRDFVDFVMKHNIKT-----VIDSVYDFEDTVEAFN 331

  Fly  1871 FMASGKHIGKVVIK 1884
            .:.:.:..|||:||
pombe   332 RLMTHRCKGKVIIK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN1NP_001137778.2 PksD 137..1142 CDD:225858
PKS 140..544 CDD:238429
KAsynt_C_assoc 502..612 CDD:292814
Acyl_transf_1 633..950 CDD:298668
hot_dog 990..1234 CDD:294345
NADB_Rossmann 1358..>1550 CDD:304358
PKS_ER 1593..1883 CDD:214840 78/330 (24%)
enoyl_red 1595..1883 CDD:176179 78/328 (24%)
KR_1_FAS_SDR_x <1901..2141 CDD:187657
PKS_PP 2154..>2206 CDD:214834
Abhydrolase 2286..2535 CDD:304388
SPBC16A3.02cNP_596787.1 Qor 14..345 CDD:223677 80/337 (24%)
MDR1 15..344 CDD:176228 80/336 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9266
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.