DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN1 and F32H2.6

DIOPT Version :9

Sequence 1:NP_001137778.2 Gene:FASN1 / 33524 FlyBaseID:FBgn0283427 Length:2540 Species:Drosophila melanogaster
Sequence 2:NP_492421.1 Gene:F32H2.6 / 185214 WormBaseID:WBGene00009343 Length:187 Species:Caenorhabditis elegans


Alignment Length:145 Identity:56/145 - (38%)
Similarity:75/145 - (51%) Gaps:17/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LFDGV-----DMVNDDPRRWERGLYGLPDRIGKLKDSDLENFDQQFFGVHQKQAECMDPLLRMLL 223
            :|.|:     |:|.:|...|..|...||.:.||.|  ||..||........||...|||.:|:||
 Worm    30 MFGGMLLACDDVVTEDQLSWAPGFTDLPKKRGKKK--DLNKFDAGILPGTSKQNNPMDPQVRLLL 92

  Fly   224 ELTHEAIIDAGLNPSDLRGSRTGVYIGVSNSETEQHWCSDADRVNGYGLTGC-----ARAMFANR 283
            |.:.||::|||:||..||||:.|.:     .|......|...:.|.....||     ..:||:||
 Worm    93 EASWEAMVDAGINPRGLRGSQIGDF-----DECATPGTSGTQKQNPVTEMGCIMSDTVPSMFSNR 152

  Fly   284 ISFTFDFKGPSYSID 298
            ||:|||.:|||:|.|
 Worm   153 ISYTFDLQGPSHSAD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN1NP_001137778.2 PksD 137..1142 CDD:225858 56/145 (39%)
PKS 140..544 CDD:238429 56/145 (39%)
KAsynt_C_assoc 502..612 CDD:292814
Acyl_transf_1 633..950 CDD:298668
hot_dog 990..1234 CDD:294345
NADB_Rossmann 1358..>1550 CDD:304358
PKS_ER 1593..1883 CDD:214840
enoyl_red 1595..1883 CDD:176179
KR_1_FAS_SDR_x <1901..2141 CDD:187657
PKS_PP 2154..>2206 CDD:214834
Abhydrolase 2286..2535 CDD:304388
F32H2.6NP_492421.1 ketoacyl-synt <58..>167 CDD:365879 46/115 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4124
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19161at2759
OrthoFinder 1 1.000 - - FOG0001625
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.