DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and CRYZL1

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_665857.2 Gene:CRYZL1 / 9946 HGNCID:2420 Length:349 Species:Homo sapiens


Alignment Length:358 Identity:78/358 - (21%)
Similarity:135/358 - (37%) Gaps:112/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MRGWQLHNYGDIDEL----QLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMR 112
            |:|.........:|:    |..|.|.:.:   .|...::::|.|::.|:..:|.        :|:
Human     1 MKGLYFQQSSTDEEITFVFQEKEDLPVTE---DNFVKLQVKACALSQINTKLLA--------EMK 54

  Fly   113 CQPGDGIEFPLILGREFCGELVQTGMGVSL--PLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPA 175
            .:..   .||  :|||..|.::..|..||.  | ...|.|::||.:......|.|.|..:.|...
Human    55 MKKD---LFP--VGREIAGIVLDVGSKVSFFQP-DDEVVGILPLDSEDPGLCEVVRVHEHYLVHK 113

  Fly   176 PKELDDYEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILK 240
            |:::...|||..:..|:.|::.|:....|         |.|   |.||::.|:...||:|||:..
Human   114 PEKVTWTEAAGSIRDGVRAYTALHYLSHL---------SPG---KSVLIMDGASAFGTIAIQLAH 166

  Fly   241 SQKVQVLAT-CS----------------------------ENAIEMVRNLGADLVVDY------- 269
            .:..:|::| ||                            |:.:|....||.|:|:|.       
Human   167 HRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCLEETGGLGVDIVLDAGVRLYSK 231

  Fly   270 -NNPQAMEELCKYAPYDIVLDCAGQGGQKAAESKYDFRQYITFSSPL------------------ 315
             :.|....:|..: .:||: ...|.||           .::|....|                  
Human   232 DDEPAVKLQLLPH-KHDII-TLLGVGG-----------HWVTTEENLQLDPPDSHCLFLKGATLA 283

  Fly   316 --------LANIDKQGLGVGALKNVFDLFQTNV 340
                    |:|: :||..:..||:|.:...|.|
Human   284 FLNDEVWNLSNV-QQGKYLCILKDVMEKLSTGV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 78/358 (22%)
Qor 52..406 CDD:223677 78/358 (22%)
CRYZL1NP_665857.2 enoyl_red 31..347 CDD:176179 72/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.