DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and TP53I3

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_004872.2 Gene:TP53I3 / 9540 HGNCID:19373 Length:332 Species:Homo sapiens


Alignment Length:344 Identity:89/344 - (25%)
Similarity:147/344 - (42%) Gaps:60/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGVS--LPL 144
            |.|:::.|:|:|..||...:|         :..|..|..  .|||.|..|.:.:.|.|..  ..:
Human    29 EVLLKVAASALNRADLMQRQG---------QYDPPPGAS--NILGLEASGHVAELGPGCQGHWKI 82

  Fly   145 GSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGLGGPCG 209
            |.....::|    .|..|:||.||...|.|.|:.|...:||::..|.|||:..|::.|.:     
Human    83 GDTAMALLP----GGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNV----- 138

  Fly   210 ATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATC-SENAIEMVRNLGADLVVDYNNPQ 273
                   .|...||:..|..||||.|||:.:......|.|. |:..::|...|||....:|....
Human   139 -------QAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKED 196

  Fly   274 AMEELCKY---APYDIVLDCAGQGGQK------AAESK---YDFRQYITFSSPLLAN-IDKQGLG 325
            ..|...|:   |..:::|||.|....:      |.:.:   |........:.||.:. :.|:|..
Human   197 FSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSL 261

  Fly   326 VGALKNVFD--LFQTNVRSVTQRGGLVKWGFFSPAPQGIQFLQKLVEQRKLMPLIDSSYGFSELP 388
            :.:|....|  ..|..|.:.|::   :...|.:..||            :|:|::|..|..:|:.
Human   262 ITSLLRSRDNKYKQMLVNAFTEQ---ILPHFSTEGPQ------------RLLPVLDRIYPVTEIQ 311

  Fly   389 KAFEKMKSGHLRGKIVVKL 407
            :|.:.|::....||||::|
Human   312 EAHKYMEANKNIGKIVLEL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 88/341 (26%)
Qor 52..406 CDD:223677 88/341 (26%)
TP53I3NP_004872.2 p53_inducible_oxidoreductase 1..328 CDD:176180 87/340 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3611
OMA 1 1.010 - - QHG53549
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3553
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.