DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and AST2

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_011027.1 Gene:AST2 / 856838 SGDID:S000000903 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:91/400 - (22%)
Similarity:163/400 - (40%) Gaps:106/400 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQT 136
            :|:|..:  |:.:|::....:||:|:.:..||...:..:.      ||      |||:.|.:...
Yeast    70 IKLPISK--NKLVVQVNYVGLNPVDMKIRNGYTKPIYGEA------GI------GREYSGVITHV 120

  Fly   137 GMGVS--LPLGSRVWGVV--------PLQAT--IGSHAEYVAV-PSYCLAPAPKELDDYEAASVL 188
            |..::  ..:|..|:|:.        .||::  |....:.:.: |...|:|.       :||..|
Yeast   121 GDNLTNRWNVGDDVYGIYYHPKLAIGALQSSLLIDPRVDPILMRPKNTLSPE-------KAAGSL 178

  Fly   189 YAGLTAWSGLYITGGLGGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILK-----SQKVQVLA 248
            :...||   |.:...|.......|.|      .||:.||:..||..|||:||     |:|:.|:.
Yeast   179 FCLGTA---LNLLAQLKEKDQLNTES------NVLINGGTSSVGMFAIQLLKRYYKVSKKLVVVT 234

  Fly   249 TCSENAI----------EMV----------------RNLGADLVVDYNNPQAMEELCKY--APYD 285
            :.:..|:          |::                |.|....||||::...::|...|  ..::
Yeast   235 SGNGAAVLSEHFPDLKDEIIFINYLSCRGKSSKPLRRMLDTGKVVDYDDFNTLKETEDYTQGKFN 299

  Fly   286 IVLDCAGQGGQKAAESKYDFRQYITFSSPLL----ANIDKQGLGVGAL-KNVFDLFQTNVRSVTQ 345
            :|||..|         .||.   ::.||.|:    |.|...|..||.. |:|||.:.....:..:
Yeast   300 VVLDFIG---------GYDI---LSHSSSLIHAKGAYITTVGDYVGNYKKDVFDSWDNPSANARK 352

  Fly   346 RGGLVKWG------FFSP----APQGIQFLQ---KLVEQRKLMPLIDSSYGFSELPKAFEKMKSG 397
            ..|.:.|.      :|.|    .|:...::.   ||:.:..:..::|..|.:....:||..|.:.
Yeast   353 MFGSMLWSYDYSHFYFDPNIKIIPKKNDWIHECGKLLNEGVVDCVVDKVYSWKNFKEAFSYMATQ 417

  Fly   398 HLRGKIVVKL 407
            ..:||:::|:
Yeast   418 RAQGKLIMKV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 90/397 (23%)
Qor 52..406 CDD:223677 90/397 (23%)
AST2NP_011027.1 AST1_like 50..427 CDD:176209 90/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1716
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.820

Return to query results.
Submit another query.