DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and ETR1

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_009582.1 Gene:ETR1 / 852314 SGDID:S000000230 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:61/241 - (25%)
Similarity:98/241 - (40%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WQLHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGI 119
            :..|...|..:: ||.....|:...|...:::..|..:||.|:..|:|...:...|......|  
Yeast    25 YSTHEVEDCTKV-LSVKNYTPKQDLSQSIVLKTLAFPINPSDINQLQGVYPSRPEKTYDYSTD-- 86

  Fly   120 EFPLILGREFCGELVQTGMGVS---LPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDD 181
            |...|.|.|...|:|....|.|   |.||.|   |:||||..|:.:.|....|........:||.
Yeast    87 EPAAIAGNEGVFEVVSLPSGSSKGDLKLGDR---VIPLQANQGTWSNYRVFSSSSDLIKVNDLDL 148

  Fly   182 YEAASVLYAGLTAWSGL--YITGGLGGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKV 244
            :.||:|...|.|.:..:  ||.....|            ::.::...|:..|..:..|:.|::.:
Yeast   149 FSAATVSVNGCTGFQLVSDYIDWNSNG------------NEWIIQNAGTSSVSKIVTQVAKAKGI 201

  Fly   245 QVLATC--SENAIEMVRNL----GADLVV--DYNNPQ--AMEELCK 280
            :.|:..  .:|..|:.:.|    ||..|:  ..||.:  |.|.|.|
Yeast   202 KTLSVIRDRDNFDEVAKVLEDKYGATKVISESQNNDKTFAKEVLSK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 61/241 (25%)
Qor 52..406 CDD:223677 61/241 (25%)
ETR1NP_009582.1 ETR 21..345 CDD:176250 61/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.