DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and YLR460C

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_013565.3 Gene:YLR460C / 851182 SGDID:S000004452 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:404 Identity:83/404 - (20%)
Similarity:150/404 - (37%) Gaps:118/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPL-----ILGR 127
            :.|.:.||::. ....|::..|.|.||.|.|                   .|::.:     |||.
Yeast    21 VKEGIPIPELE-EGFVLIKTLAVAGNPTDWA-------------------HIDYKIGPQGSILGC 65

  Fly   128 EFCGELVQTGMGVS---LPLGSRVWGVVPLQA----TIGSHAEYVAVPSYCLAPAPKELD----- 180
            :..|::|:.|..|:   ..:|..::|.:...:    :.|:.|||.|:.:.....:|.||.     
Yeast    66 DAAGQIVKLGPAVNPKDFSIGDYIYGFIHGSSVRFPSNGAFAEYSAISTVVAYKSPNELKFLGED 130

  Fly   181 --------DYEAASVLYAGLTAWSGLYITGGLG-------------GPCGATTASGGGAHKRVLV 224
                    ..|..:.:...||. :||.:|..||             ||              :|:
Yeast   131 VLPAGPVRSLEGVATIPVSLTT-AGLVLTYNLGLDLKWEPSTPQRKGP--------------ILL 180

  Fly   225 LGGSGGVGTLAIQILKSQK--VQVLATCSENAIEMVRNLGADLVVDYNNPQAMEEL-CKYAPYDI 286
            .||:..||...||:.....  .:::...|....::::..|||.:.||::...:|:: .||.....
Yeast   181 WGGATAVGQSLIQLANKLNGFTKIIVVASRKHEKLLKEYGADELFDYHDIDVVEQIKHKYNNISY 245

  Fly   287 VLDCAGQGGQKAAESKYDFRQYITFSSPLLANIDKQGLGVGALKNVFDLFQTNVRSVTQR----- 346
            ::||.  ..|...:..|.            ...|||...:..|||   |.:.||:...:|     
Yeast   246 LVDCV--ANQDTLQQVYK------------CAADKQDATIVELKN---LTEENVKKENRRQNVTI 293

  Fly   347 ---------GGLVKWGFFS-PAP--------QGIQFLQKLVE--QRKLMPLIDSSYGFSELPKAF 391
                     |..|.:|..: ||.        :.|:|:...:.  |.:.:|:.....|..::|...
Yeast   294 DIIRLYSIGGHEVPFGNITLPADSEARKAAIKFIKFINPKINDGQIRHIPVRVYKNGLCDVPHIL 358

  Fly   392 EKMKSGHLRGKIVV 405
            :.:|.|...|:.:|
Yeast   359 KDIKYGKNSGEKLV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 83/404 (21%)
Qor 52..406 CDD:223677 83/404 (21%)
YLR460CNP_013565.3 enoyl_reductase_like 9..375 CDD:176211 83/404 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.