DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and NQR

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001185182.1 Gene:NQR / 841391 AraportID:AT1G49670 Length:652 Species:Arabidopsis thaliana


Alignment Length:384 Identity:89/384 - (23%)
Similarity:143/384 - (37%) Gaps:120/384 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGV-SLPL 144
            ::.|::|....||..|:....|         |...|...:.|...|.|..|.:...|..| :|.:
plant   317 HQVLLKIIYAGVNASDVNFSSG---------RYFTGGSPKLPFDAGFEGVGLIAAVGESVKNLEV 372

  Fly   145 GSRVWGVVPLQA-TIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSG----------- 197
            |:      |... |.|:::||:.|.|..:.|.|:  .|.|..::|.:||||...           
plant   373 GT------PAAVMTFGAYSEYMIVSSKHVLPVPR--PDPEVVAMLTSGLTALIALEKLYDILKLL 429

  Fly   198 --LYITGGLGGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATC--SENAIEMV 258
              |.:|..|.  .|.:.|....:.:.|||...:||.|..|:|:.|....:|:|||  ||.| :::
plant   430 VQLSLTFSLS--YGNSQAGQMKSGETVLVTAAAGGTGQFAVQLAKLSGNKVIATCGGSEKA-KLL 491

  Fly   259 RNLGADLVVDYNNPQAMEELCKYAP--------------YDIVLDC---------AGQGGQKAAE 300
            :.||.|.|:||.:......|.|..|              :|:.|:.         .|...|...|
plant   492 KELGVDRVIDYKSENIKTVLKKEFPKGVNIIYESVGGQMFDMCLNALAVYGRLIVIGMISQYQGE 556

  Fly   301 SKYDFRQYITFSSPLLA-------------------NIDKQGLGVGALKNVFDLFQTNVRSVTQR 346
            ..::..:|......:||                   |:||          :|:|:..        
plant   557 KGWEPAKYPGLCEKILAKSQTVAGFFLVQYSQLWKQNLDK----------LFNLYAL-------- 603

  Fly   347 GGLVKWGFFSPAPQGIQFLQKLVEQRKLMPLIDSSYGFSELPKAFEKMKSGHLRGKIVV 405
             |.:|.|               ::|:|.:       |.:.:..|.|.:.||...||:||
plant   604 -GKLKVG---------------IDQKKFI-------GLNAVADAVEYLHSGKSTGKVVV 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 89/384 (23%)
Qor 52..406 CDD:223677 89/384 (23%)
NQRNP_001185182.1 ADH_SDR_c_like 9..254 CDD:187584
adh_short 9..210 CDD:278532
CurA 285..639 CDD:225041 87/382 (23%)
Mgc45594_like 286..640 CDD:176212 89/384 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.