DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and AT4G21580

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_193889.1 Gene:AT4G21580 / 828243 AraportID:AT4G21580 Length:325 Species:Arabidopsis thaliana


Alignment Length:361 Identity:94/361 - (26%)
Similarity:159/361 - (44%) Gaps:61/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLIL 125
            |..:.|||.::.. |::: .:|.|:|:.|||:|..|.....|    :.|.   .||..   | .|
plant    10 GKPEVLQLRDVAD-PEVK-DDEVLIRVLATALNRADTLQRLG----LYNP---PPGSS---P-YL 61

  Fly   126 GREFCGELVQTGMGVS-LPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLY 189
            |.|..|.:...|.||| ..:|.:|..::    :.|.:||.|:||:..:.|.|..:...:||:...
plant    62 GLECSGTIESVGKGVSRWKVGDQVCALL----SGGGYAEKVSVPAGQIFPIPAGISLKDAAAFPE 122

  Fly   190 AGLTAWSGLYITGGLGGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATC-SEN 253
            ...|.||.:::.|.|            ...:..|:.|||.|:||.||||.|...|:|..|. |:.
plant   123 VACTVWSTVFMMGRL------------SVGESFLIHGGSSGIGTFAIQIAKHLGVRVFVTAGSDE 175

  Fly   254 AIEMVRNLGADLVVDYNNPQAMEELCKYAP---YDIVLDCAGQGG-QKAAES-KYDFRQYITFSS 313
            .:...:.||||:.::|.....:.::.....   .|::|||.|... ||..:| .:|.|..|.   
plant   176 KLAACKELGADVCINYKTEDFVAKVKAETDGKGVDVILDCIGAPYLQKNLDSLNFDGRLCII--- 237

  Fly   314 PLLANIDKQGLGVGALKNVFDLFQTNVRSVTQRGGLVKWGFFSPAPQG----IQFLQK----LVE 370
                     ||..||...: .|.....:.:|..|..::    ..:|:.    ::.::|    .:|
plant   238 ---------GLMGGANAEI-KLSSLLPKRLTVLGAALR----PRSPENKAVVVREVEKNVWPAIE 288

  Fly   371 QRKLMPLIDSSYGFSELPKAFEKMKSGHLRGKIVVK 406
            ..|:.|:|......|:..:....|:|.:..|||:::
plant   289 AGKVKPVIYKYLPLSQAAEGHSLMESSNHIGKILLE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 94/359 (26%)
Qor 52..406 CDD:223677 94/359 (26%)
AT4G21580NP_193889.1 p53_inducible_oxidoreductase 1..323 CDD:176180 94/358 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53549
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2813
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.