DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and MECR

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011539841.1 Gene:MECR / 51102 HGNCID:19691 Length:459 Species:Homo sapiens


Alignment Length:199 Identity:46/199 - (23%)
Similarity:85/199 - (42%) Gaps:27/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LKIPQIRCSNECLVRIRATAVNPIDLAMLRG-YGATVLNKMRCQPGDGIEFPLILGREFCGELVQ 135
            |::..:| .::..|::.|..:||.|:.|::| ||...            |.|.:.|.|...::|.
Human    91 LELAAVR-GSDVRVKMLAAPINPSDINMIQGNYGFLP------------ELPAVGGNEGVAQVVA 142

  Fly   136 TGMGVS-LPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLY 199
            .|..|: |..|.  | |:|..|.:|:...........|...|.::....||::.....||:..|.
Human   143 VGSNVTGLKPGD--W-VIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLM 204

  Fly   200 ITGGL-GGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGA 263
            ....| .|......||..|..:.|:.:..:.|:.|:.: :.....:|.|:       :.:::|||
Human   205 DFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINV-VRDRPDIQKLS-------DRLKSLGA 261

  Fly   264 DLVV 267
            :.|:
Human   262 EHVI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 46/199 (23%)
Qor 52..406 CDD:223677 46/199 (23%)
MECRXP_011539841.1 ETR 44..459 CDD:176250 46/199 (23%)
Qor 100..>269 CDD:223677 44/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.