Sequence 1: | NP_001259984.1 | Gene: | CG17221 / 33521 | FlyBaseID: | FBgn0031500 | Length: | 413 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011539841.1 | Gene: | MECR / 51102 | HGNCID: | 19691 | Length: | 459 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 46/199 - (23%) |
---|---|---|---|
Similarity: | 85/199 - (42%) | Gaps: | 27/199 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 LKIPQIRCSNECLVRIRATAVNPIDLAMLRG-YGATVLNKMRCQPGDGIEFPLILGREFCGELVQ 135
Fly 136 TGMGVS-LPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLY 199
Fly 200 ITGGL-GGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGA 263
Fly 264 DLVV 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17221 | NP_001259984.1 | RTN4I1 | 52..406 | CDD:176210 | 46/199 (23%) |
Qor | 52..406 | CDD:223677 | 46/199 (23%) | ||
MECR | XP_011539841.1 | ETR | 44..459 | CDD:176250 | 46/199 (23%) |
Qor | 100..>269 | CDD:223677 | 44/189 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0604 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |