DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Stpg2

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_008759742.2 Gene:Stpg2 / 499719 RGDID:1591946 Length:574 Species:Rattus norvegicus


Alignment Length:302 Identity:57/302 - (18%)
Similarity:97/302 - (32%) Gaps:115/302 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 ATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYA---GLTAWSGLYITG-----GLGGPC---- 208
            |..||..|:|...:| ..|.||     :.|:..||   .|::....|:..     .:.||.    
  Rat    12 ANRGSTEEHVGPGTY-QVPFPK-----QQATGCYAPFLSLSSKKDAYVVSSDPGKAVPGPAHYNV 70

  Fly   209 --------GATTASGGGAHKRVLVLGGSGG-------VGTLAIQILKSQKVQVLATCSENAIEMV 258
                    |..|........:.|:..|.|.       :|||.|:|  .||:     |.:.|:...
  Rat    71 SQAQYKIKGGRTLQNREKRFKKLISDGPGPASYDCPYLGTLCIRI--RQKI-----CRKPAVSRS 128

  Fly   259 --------------RNLGADLVVDYNNPQAMEELCKYAPYDIVLDCAGQGGQKAAESKYDFRQYI 309
                          .:|..|..:....|.:.::....|.|:               .::|:.:  
  Rat   129 LDIPSIPSSGKSHGYHLNEDDTIMRRTPPSSDKTMGPAYYN---------------PQFDYPK-- 176

  Fly   310 TFSSPLLANIDKQGLGVGALKNVFDLFQTNVRSVTQRGGLVKWGFFSPAPQGIQFLQKLVEQRKL 374
                   |::..:|:..|.              .|.|..|:|:.  .|.|.....:||    |||
  Rat   177 -------ASLKYKGVNFGI--------------ATGRQELLKYS--GPGPGHYDIIQK----RKL 214

  Fly   375 ------MPLIDSSYGFSELPKAFEKMKSGHLRGKIVVKLREE 410
                  :......|.:|.:|:.:|:           :.|:||
  Rat   215 RYENINIKRDQEHYCYSYVPRLYEE-----------IALQEE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 54/296 (18%)
Qor 52..406 CDD:223677 54/296 (18%)
Stpg2XP_008759742.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.