DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and cryz

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001005689.1 Gene:cryz / 448193 XenbaseID:XB-GENE-966820 Length:329 Species:Xenopus tropicalis


Alignment Length:388 Identity:85/388 - (21%)
Similarity:139/388 - (35%) Gaps:104/388 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MRGWQLHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPG 116
            ||..::..:|..|.|:|...|.:|. ...||.|:|:.|..:||::..:..|..|.       :| 
 Frog     8 MRAIRVFEFGKADVLKLCTDLPLPS-PGKNEVLIRVHACGINPVETYIRAGTYAR-------KP- 63

  Fly   117 DGIEFPLILGREFCGELVQTGMGVSL-PLGSRVWGVVPLQATI-GSHAEYVAVPSYCLAPAPKEL 179
               ..|...|.:..|.:...|..|:| ..|.||:    ..:|| |.:|||....:..:.|.|..|
 Frog    64 ---TLPYTPGTDVAGVIESVGKDVTLFKRGDRVF----TTSTISGGYAEYSIASADTVYPLPDLL 121

  Fly   180 DDYEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHKR----VLVLGGSGGVGTLAIQILK 240
            ...:.|::.....||:..|:                ..||.|    :||.|.|||||..|.||.:
 Frog   122 SFKQGAAISIPYFTAYRALF----------------SKAHGRPGEVILVHGASGGVGIAACQIAR 170

  Fly   241 SQKVQVLATC-SENAIEMVRNLGADLVVDYNNP---QAMEELCKYAPYDIVLDCAGQGGQKAAES 301
            :...:|..|. :...:.:|...||..|.::...   ..::|....|..|::|:            
 Frog   171 AYGFRVFGTAGTPEGLNLVLKNGAHKVFNHREEDYIDKIQEATGGAGVDVILE------------ 223

  Fly   302 KYDFRQYITFSSPLLANIDKQGLGVGALKNVFDLFQTNVR----------SVTQRGGLVKWGFFS 356
                         :|:|::        |.:..:|.....|          .:..|..:.|    .
 Frog   224 -------------MLSNVN--------LSHDLNLLAAGGRVIIVGCRGPIEINPRDTMAK----E 263

  Fly   357 PAPQGIQFLQKLVEQRK--------------LMPLIDSSYGFSELPKAFEK-MKSGHLRGKIV 404
            .:..|:.......|.|.              |.|||...|...:..:|.|. ::|....||:|
 Frog   264 TSIIGVSLFSATKEDRMETAAALFGGMEAGWLKPLIGCEYPLEKASQAHEDIIQSSGASGKMV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 85/388 (22%)
Qor 52..406 CDD:223677 85/388 (22%)
cryzNP_001005689.1 zeta_crystallin 8..329 CDD:176215 85/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3553
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.