DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Sodh-2

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_524311.1 Gene:Sodh-2 / 41313 FlyBaseID:FBgn0022359 Length:360 Species:Drosophila melanogaster


Alignment Length:400 Identity:90/400 - (22%)
Similarity:145/400 - (36%) Gaps:99/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLR--GYGATVLNKMRCQPGDGI 119
            ||.   |::|:| |...||:| ..:|.|:.:.:..:...|:..|.  ..|..||.|         
  Fly    10 LHG---IEDLRL-EQRPIPEI-ADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK--------- 60

  Fly   120 EFPLILGREFCGELVQTGMGV-SLPLGSRVWGVVP-LQATIGSHAE-----------YVAVPSY- 170
              |:|:|.|..|.:.:.|..| :|.:|.|| .:.| :......|.:           :.|.|.| 
  Fly    61 --PMIIGHEAAGVVAKLGKKVTTLKVGDRV-AIEPGVPCRYCDHCKQGRYNLCADMVFCATPPYD 122

  Fly   171 -------------CLAPAPKELDDYEAASVLYAGLTAWSGLYITGGLGGPCG----ATTASGGGA 218
                         |.     :|.|:.:..              .|.|..|..    |...:|.|.
  Fly   123 GNLTRYYKHAADFCF-----KLPDHVSME--------------EGALLEPLSVGVHACRRAGVGL 168

  Fly   219 HKRVLVLGGS--GGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGADLVVDYNNPQAMEELCKY 281
            ..:||:||..  |.|..||.|.:.:.:: ::....:..:::.:.|||...:.....|:.||..|.
  Fly   169 GSKVLILGAGPIGLVTLLAAQAMGASEI-LITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKV 232

  Fly   282 APY------DIVLDCAGQGGQKAAESKYDFRQYITFSSPLLANIDKQGLGVGALKNVFDLFQTNV 340
            ...      |..:||.|      |||......:.|.|..::..:     |:||.:....|.....
  Fly   233 VHQTMSEVPDKSIDCCG------AESSARLAIFATRSGGVVVVV-----GMGAPEVKLPLINALA 286

  Fly   341 RSVTQRGGLVKWGFFSPAPQGIQFLQKLVEQRK--LMPLIDSSYGFSELPKAFEKMKSGHLRGKI 403
            |.:..||.......:|.|       ..||...|  :..|:...|..:|..:|||..:.| ..|.|
  Fly   287 REIDIRGVFRYCNDYSAA-------LALVASGKVNVKRLVTHHYDITETAEAFETSRRG-TGGAI 343

  Fly   404 VVKLREETGD 413
            .|.:..:..|
  Fly   344 KVMIHVQPRD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 88/391 (23%)
Qor 52..406 CDD:223677 88/391 (23%)
Sodh-2NP_524311.1 PLN02702 4..346 CDD:215378 88/391 (23%)
sorbitol_DH 8..349 CDD:176188 89/394 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.