DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Sodh-1

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster


Alignment Length:396 Identity:88/396 - (22%)
Similarity:142/396 - (35%) Gaps:91/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLR--GYGATVLNKMRCQPGDGI 119
            ||.   |::::| |...||:| ..:|.|:.:.:..:...|:..|.  ..|..||.|         
  Fly    10 LHG---IEDMRL-EQRPIPEI-ADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK--------- 60

  Fly   120 EFPLILGREFCGELVQTGMGV-SLPLGSRVW---GVVPLQATIGSHAEYVAVPS--YCLAP---- 174
              |:|:|.|..|.:.:.|..| :|.:|.||.   ||...:.......:|...|.  :|..|    
  Fly    61 --PMIIGHESAGVVAKLGKKVTTLKVGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATPPYDG 123

  Fly   175 ---------------APKELDDYEAASV--LYAGLTAWSGLYITGGLGGPCGATTASGGGAHKRV 222
                           .|..:...|.|.:  |..|:.|.....:|.|                .:|
  Fly   124 NLTRYYKHAADFCFKLPDHVTMEEGALLEPLSVGVHACKRAEVTLG----------------SKV 172

  Fly   223 LVLGGS--GGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGADLVVDYNNPQAMEELCKYAPY- 284
            |:||..  |.|..:|.|.:.:.:: ::....:..:::.:.|||...:.....|..||....... 
  Fly   173 LILGAGPIGLVTLMAAQAMGASEI-LITDLVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKT 236

  Fly   285 -----DIVLDCAGQGGQKAAESKYDFRQYITFSSPLLANIDKQGLGVGALKNVFDLFQTNVRSVT 344
                 |..:||.|      |||......:.|.|..::..:     |:||.:....|.....|.|.
  Fly   237 MGGQPDKSIDCCG------AESSARLAIFATRSGGIVVVV-----GMGAAEIKLPLINALAREVD 290

  Fly   345 QRGGLVKWGFFSPAPQGIQFLQKLVEQRK--LMPLIDSSYGFSELPKAFEKMKSGHLRGKIVVKL 407
            .||.......::.|       ..||...|  :..|:...:...|..||||..:.| |.|.|.|.:
  Fly   291 IRGVFRYCNDYAAA-------LALVASGKVNVKRLVTHHFDIKETAKAFETSRKG-LGGAIKVMI 347

  Fly   408 REETGD 413
            ..:..|
  Fly   348 HVQPRD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 86/387 (22%)
Qor 52..406 CDD:223677 86/387 (22%)
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 86/387 (22%)
sorbitol_DH 8..349 CDD:176188 87/390 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.