DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and cryz

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001093446.1 Gene:cryz / 407640 ZFINID:ZDB-GENE-050306-24 Length:328 Species:Danio rerio


Alignment Length:238 Identity:60/238 - (25%)
Similarity:96/238 - (40%) Gaps:47/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MRGWQLHNYGDIDELQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPG 116
            ||..::..:|....|:|...|.:|. ....:.|:|:.|..|||::..:..|..|.       :| 
Zfish     7 MRAVRVSEFGGPSVLKLCSDLPVPS-PGQKQVLIRVHACGVNPVETYIRSGSYAR-------KP- 62

  Fly   117 DGIEFPLILGREFCGELVQTGMGVS-LPLGSRVW--GVVPLQATIGSHAEYVAVPSYCLAPAPKE 178
               ..|...|.:..|.:...|.||. |..|.||:  |.|     .|.:|||.......:...|..
Zfish    63 ---SLPYTPGSDVSGVVEAVGEGVCLLQAGDRVFTTGTV-----TGGYAEYTVASEDTVHKLPDS 119

  Fly   179 LDDYEAASVLYAGLTAWSGLYITGGLGGPCGATTASGGGAHK-------RVLVLGGSGGVGTLAI 236
            |:..:.|::.....||:..|                   .||       .||:.|.|||||..|.
Zfish   120 LNYCQGAAMGVPYFTAYRAL-------------------VHKAHAKPGETVLIHGASGGVGIAAC 165

  Fly   237 QILKSQKVQVLATC-SENAIEMVRNLGADLVVDYNNPQAMEEL 278
            ||.::..::||.|. :...:::|.|.||.|..::.....:|::
Zfish   166 QIARAFGLKVLGTAGTPEGMKLVLNNGAHLAFNHREKDYLEKI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 60/238 (25%)
Qor 52..406 CDD:223677 60/238 (25%)
cryzNP_001093446.1 Qor 7..328 CDD:223677 60/238 (25%)
zeta_crystallin 7..328 CDD:176215 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3553
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.