DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Stpg2

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_036019039.1 Gene:Stpg2 / 381476 MGIID:2685863 Length:562 Species:Mus musculus


Alignment Length:154 Identity:35/154 - (22%)
Similarity:66/154 - (42%) Gaps:36/154 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 VDYNNPQAMEELCKYA-----PYDIV----LDCAGQGGQKAAESKYDFRQYI-TFSSPLLANIDK 321
            |::.|....:|..||:     .|||:    |.|.....::  |.::::..|: .....::...:|
Mouse   184 VNFGNATGRQEFLKYSGPGPGQYDIIQKRKLHCENINIKR--EQEHNYYTYVPRLYEAIILQEEK 246

  Fly   322 QGL-GVGA--LKNVFDLFQTNVRSVTQRGGLVKWGFFS------------PAP---QGIQFLQKL 368
            :|: |.|.  :|:.||:    ::|::.......:.|||            |||   ..|:...|.
Mouse   247 KGVPGPGKYNIKSEFDM----IKSMSALVNSPSFIFFSETERFEPIKSCTPAPGTYNEIRTAFKC 307

  Fly   369 VEQR--KLMPLIDSSYGFSELPKA 390
            .::|  ..:|...|:..|:|..||
Mouse   308 PKKRFGLSLPFNQSAARFTEDSKA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 35/154 (23%)
Qor 52..406 CDD:223677 35/154 (23%)
Stpg2XP_036019039.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.