DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and CG16935

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001286396.1 Gene:CG16935 / 36540 FlyBaseID:FBgn0033883 Length:357 Species:Drosophila melanogaster


Alignment Length:386 Identity:87/386 - (22%)
Similarity:137/386 - (35%) Gaps:119/386 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAAGFNSILCLRQLVRLN----RRQYSAPAKSVLSGSQTNDQATPPPTSKSADKMRGWQLHNYG 61
            |...||        |.|:|    .||.|..|||:                         :...:|
  Fly     1 MLRRGF--------LSRINAAQWSRQMSVVAKSL-------------------------KYTQHG 32

  Fly    62 DIDE-LQLSEMLKIPQIRCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLIL 125
            :..| |||.|. |:|..: .|:.||:|.|..:||.|:..::|       |...:|    :||.:.
  Fly    33 EPQEVLQLVED-KLPDPK-DNQVLVKILAAPINPADINTIQG-------KYPVKP----KFPAVG 84

  Fly   126 GREFCGELVQTGMGVSLPLGSRVWG------VVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEA 184
            |.|...|::        .:|.:|.|      |:||.:.:|:...:.......|....|::...||
  Fly    85 GNECVAEVI--------CVGDKVKGFEAGQHVIPLASGLGTWTTHAVYKEDQLLIVSKKVGLAEA 141

  Fly   185 ASVLYAGLTAWSGL-----YITGGLGGPCGATTASGGGAH-----------------------KR 221
            |:......||:..|     ...|......||.:|.|...|                       |:
  Fly   142 ATSTVNPTTAYRMLKDFVQLCPGDTVIQNGANSAVGQAVHQLCRAWGINSVGIVRDRPEIAELKQ 206

  Fly   222 VLVLGGSGGVGTLA----IQILKS---QKVQVLATC--SENAIEMVRNL-GADLVVDYNNPQAME 276
            :|...|:..|.|.|    ..|.||   :|.::...|  .::|.|:.|:| ...::|.|.......
  Fly   207 MLQCLGATEVLTEAEIRTSDIFKSGKLKKPRLAFNCVGGKSATEVSRHLDNGGVLVTYGGMSREP 271

  Fly   277 ELCKYAPYDIVLDCAGQGGQKAAESKYDFRQYITFSSPLLANIDKQGLGVGALKNVFDLFQ 337
            ......|. |..|.|.:|......||.:      :|||..:.:         .|.:|:|.:
  Fly   272 VTVATGPL-IFKDIAFRGFWMTRWSKEN------YSSPERSKM---------FKEIFELME 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 75/331 (23%)
Qor 52..406 CDD:223677 75/331 (23%)
CG16935NP_001286396.1 ETR 23..355 CDD:176250 78/356 (22%)
Qor 23..349 CDD:223677 78/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.