DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Mecr

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_058905.1 Gene:Mecr / 29470 RGDID:3208 Length:373 Species:Rattus norvegicus


Alignment Length:296 Identity:69/296 - (23%)
Similarity:126/296 - (42%) Gaps:40/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LNRRQYSAPAKSVLSGSQTNDQATPPPTSKS------ADKMRGWQLHNYGDIDELQLSEMLKIPQ 76
            ::||...|.|::.|..|..........|:.|      ...:|.....|:||..::...:.|::..
  Rat     3 VSRRLTGARARAPLLASLLEAWCRQGRTTSSYSAFSEPSHVRALVYGNHGDPAKVIQLKNLELTA 67

  Fly    77 IRCSNECLVRIRATAVNPIDLAMLRG-YGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGV 140
            :. .::..|::.|..:||.|:.|::| ||  :|.|:          |.:.|.|..|:::..|..|
  Rat    68 VE-GSDVHVKMLAAPINPSDINMIQGNYG--LLPKL----------PAVGGNEGVGQVIAVGSSV 119

  Fly   141 S-LPLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGL 204
            | |..|.  | |:|..|.:|:...........|...||::....||::.....||:..|.....|
  Rat   120 SGLKPGD--W-VIPANAGLGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQL 181

  Fly   205 -GGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGADLVV- 267
             .|......||..|..:.|:.:..:.|:.|:.: |.....::.|.       :.:::||||.|: 
  Rat   182 QPGDSVIQNASNSGVGQAVIQIASALGLKTINV-IRDRPDIKKLT-------DRLKDLGADYVLT 238

  Fly   268 --DYNNPQAMEELCKYAPYD-IVLDCAGQGGQKAAE 300
              :...|:. :.:.|..|.. :.|:|.  ||:.:.|
  Rat   239 EEELRMPET-KNIFKDLPLPRLALNCV--GGKSSTE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 61/256 (24%)
Qor 52..406 CDD:223677 61/256 (24%)
MecrNP_058905.1 ETR 44..373 CDD:176250 61/255 (24%)
Qor 44..359 CDD:223677 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.