DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and Vat1l

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011246696.1 Gene:Vat1l / 270097 MGIID:2142534 Length:422 Species:Mus musculus


Alignment Length:411 Identity:106/411 - (25%)
Similarity:164/411 - (39%) Gaps:106/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AKSVLSGSQTNDQATPPPTSK-------------SADKMRGWQLHNYGDIDELQLS-EMLKIPQI 77
            ||..:..::..:|.....|||             .|.:||...|..:|.:::|:|| :.:..|| 
Mouse     2 AKEGVEKAEETEQMIEKETSKEPAEGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLSRKAMPEPQ- 65

  Fly    78 RCSNECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGVSL 142
              ..|..:|::|..:|.|||.:.:|   .:.|..:.        ||:.|.| |..:|: .:|.|:
Mouse    66 --DGELKIRVKACGLNFIDLMVRQG---NIDNPPKT--------PLVPGFE-CSGIVE-ALGDSV 115

  Fly   143 ---PLGSRVWGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGL 204
               .:|.||...|...|    .||.|..|...:...|.::...|||:.....:||::.|:....|
Mouse   116 KGYEIGDRVMAFVNYNA----WAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYTMLFEIANL 176

  Fly   205 GGPCGATTASGGGAHKRVLVLGGSGGVGTLAIQILKS-QKVQVLATCSENAIEMVRNLGADLV-- 266
                    ..|    ..|||....||||....|:..: ..|.|..|.|....|.:::....|.  
Mouse   177 --------REG----MSVLVHSAGGGVGQAVAQLCSTVPNVTVFGTASTFKHEAIKDSVTHLFDR 229

  Fly   267 -VDYNNPQAMEELCKYAP--YDIVLDC-AGQGGQKAAESKYDFRQYITFSSPLLANIDKQGLGVG 327
             .||     ::|:.:.:.  .|||||| .|                           |..|.|:.
Mouse   230 NADY-----VQEVKRISAEGVDIVLDCLCG---------------------------DNTGKGLS 262

  Fly   328 ALK--NVFDLFQTNVRSVTQRGGLVKWGFFSPAPQGIQFLQ----KLVEQRKLMPLIDSSYGFSE 386
            .||  ..:.|:.:: ..||   |..| .|||.|....|..:    ||.|:.|::.      |||.
Mouse   263 LLKPLGTYILYGSS-NMVT---GETK-SFFSFAKSWWQVEKVNPIKLYEENKVIA------GFSL 316

  Fly   387 LPKAFEKMKSGHLRGKIVVKL 407
            |...|::.:||.:|| :|.||
Mouse   317 LNLLFKQGRSGLIRG-VVEKL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 97/370 (26%)
Qor 52..406 CDD:223677 97/370 (26%)
Vat1lXP_011246696.1 MDR3 41..358 CDD:176236 98/372 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.