DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and SPAC2E1P3.01

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_593982.1 Gene:SPAC2E1P3.01 / 2541784 PomBaseID:SPAC2E1P3.01 Length:348 Species:Schizosaccharomyces pombe


Alignment Length:351 Identity:93/351 - (26%)
Similarity:146/351 - (41%) Gaps:55/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ECLVRIRATAVNPIDLAMLRGYGATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGV--SLPL 144
            |.|.|:...|.||||...|  |.|:            ||...:.|.:|...:...|.||  |..:
pombe    27 EFLGRVIRVAFNPIDWKTL--YNAS------------IEKGTVGGTDFVAVVEDVGEGVDRSKYI 77

  Fly   145 GSRV--WGVVPLQATIGSHAEYVAVPSYCLAPAPKELDDYEAASVLYAGLTAWSGL--YITGGLG 205
            |:.|  |...||..:..:..||:.:....:...||.:...:||::.....||..||  |    ||
pombe    78 GATVSGWAPGPLDGSNAAWREYITLDVNLVYFVPKNITPSQAATLPLTFTTASQGLNQY----LG 138

  Fly   206 GPCGATTASGGGAHKR-VLVLGGSGGVGTLAIQILKSQKVQVLATCSENAIEMVRNLGADLVVDY 269
            .|...|..|...|.:: |||..||..||...:|:......:|:||||.:..:.::.||||..|||
pombe   139 LPLPPTDGSKNSAQQKWVLVWSGSSSVGQYVVQLAHHAGYKVIATCSPHNFDWIKKLGADFTVDY 203

  Fly   270 NNPQAMEELCKYAPYDIV---LDCA-----GQGGQKAAESKY-DFRQYITFSSPLLANIDKQGLG 325
            ::|..: |:.|.|..|.|   .|.|     .....||..||. |.:.....|||.....:.:.:|
pombe   204 HDPNVV-EIIKKATDDSVFYGFDAASFPETSTLAVKAFSSKVKDGKLINILSSPPSPRSEVKIIG 267

  Fly   326 V---GALKNVFDLFQTNVRSVTQRGGLVKWGFFSPAPQGIQFLQKL---VEQRKLMP--LIDSSY 382
            :   ......|:.|...:..:.           :.....::..:||   :::..::|  :.:...
pombe   268 IIDYSLFNREFNFFGNKIEPIQ-----------ASYDHAVEVYKKLTGWLQEGVIIPNRVKEFDG 321

  Fly   383 GFSELPKAFEKMKSG-HLRGKIVVKL 407
            |...:|||..:..|| |...|.||::
pombe   322 GLQAIPKALREFASGKHSAVKFVVRI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 92/348 (26%)
Qor 52..406 CDD:223677 92/348 (26%)
SPAC2E1P3.01NP_593982.1 enoyl_reductase_like 1..347 CDD:176211 93/349 (27%)
Qor 1..347 CDD:223677 93/349 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.