DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17221 and ZK829.7

DIOPT Version :9

Sequence 1:NP_001259984.1 Gene:CG17221 / 33521 FlyBaseID:FBgn0031500 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_502269.1 Gene:ZK829.7 / 178132 WormBaseID:WBGene00014096 Length:372 Species:Caenorhabditis elegans


Alignment Length:303 Identity:65/303 - (21%)
Similarity:107/303 - (35%) Gaps:117/303 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RATAVNPI-DLAMLRGY---GATVLNKMRCQPGDGIEFPLILGREFCGELVQTGMGVSLPLGSRV 148
            :|...|.| |.::..||   |........|.|||                      ..|.:|.:|
 Worm    56 QARITNGIKDTSLFPGYEVSGIVESFGAECTPGD----------------------YDLTIGDKV 98

  Fly   149 WGVVPLQATIGSH--AEYVAVPS-YCLAPAPKELDDYEAASVLYAGLTAWSGLYITGGLGGPCGA 210
              :|.....:.||  |:|||||: :.|...|:.| ....||:|                  |.||
 Worm    99 --IVWPTDEMCSHGYADYVAVPTLHFLVKIPETL-SMHVASIL------------------PAGA 142

  Fly   211 TTASGGGAHKRVLV-------------LGGSGGVGTLAIQILK-------SQKVQVL-ATCSENA 254
            |.|.......|.:|             :.|:||:|...:::.|       .:|:::: |...|..
 Worm   143 TWALSAVLQARPIVEAFSQSKGFCNILIVGAGGLGLWLLKLAKHFLAINNDKKIRLMVADAKEER 207

  Fly   255 IEMVRNLGADLVVDYNNPQAMEELCKYAPYDIVLDCAGQGGQKAAESKYDFRQYITFSSPLLANI 319
            :.:....|||.||.:::.                               :|.:|:...:   .::
 Worm   208 LSLAERNGADFVVHWDDS-------------------------------EFEEYLIMRT---KDV 238

  Fly   320 DKQGLGVGALKNVFDLFQTNVRSVTQ------RGGLVKWGFFS 356
            .:.|:.|     ||| |.|:.|:||:      .||::..|..|
 Worm   239 ARTGVNV-----VFD-FVTSPRTVTRSLKCLAEGGVLFVGGLS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17221NP_001259984.1 RTN4I1 52..406 CDD:176210 65/303 (21%)
Qor 52..406 CDD:223677 65/303 (21%)
ZK829.7NP_502269.1 MDR 24..347 CDD:388358 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.