DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and Cnih4

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_084407.1 Gene:Cnih4 / 98417 MGIID:1925828 Length:139 Species:Mus musculus


Alignment Length:136 Identity:62/136 - (45%)
Similarity:92/136 - (67%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETATFCITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLLLLGG 69
            |...|..:||...|::.|.:|:::||:||||||:||:.||.:||.||||:...|.::.||:|:..
Mouse     2 EAVVFLFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTIVTVLMLVSL 66

  Fly    70 HWVMFLLNLPMVIWLFYELHRQRRDSLGVYDPVDIHSRGLLKVHLRNCMIYLGYYFVMFFVGLYC 134
            ||.:||||||:..|..|........::||:||.:||:||.||.|::..||.||:|.:.||:.||.
Mouse    67 HWFIFLLNLPVATWNIYRFIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFYLLCFFMYLYS 131

  Fly   135 LISSLI 140
            :|.:||
Mouse   132 MILALI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 56/124 (45%)
Cnih4NP_084407.1 Cornichon 3..130 CDD:308754 56/126 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839986
Domainoid 1 1.000 136 1.000 Domainoid score I4944
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5932
Inparanoid 1 1.050 141 1.000 Inparanoid score I4467
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59615
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - oto94608
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.