DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cnir and ERV14

DIOPT Version :9

Sequence 1:NP_608745.1 Gene:cnir / 33520 FlyBaseID:FBgn0243513 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_011461.1 Gene:ERV14 / 852826 SGDID:S000003022 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:52/150 - (34%)
Similarity:78/150 - (52%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLPETATFCITLLVYGAILLLLIYYVLTLADLECDYLNAQECCRRLNFWVIPKFGSHALLCVLL 65
            :|:......||.|  :|.:...::|     ||||.||:|..|.|.::|..:.|:...|..|.:|.
Yeast     5 LFILAVVVNCINL--FGQVHFTILY-----ADLEADYINPIELCSKVNKLITPEAALHGALSLLF 62

  Fly    66 LLGGHWVMFLLNLPMVIWLFYELHRQRRDSLGVYDPVDIHS-----RGLLKVHLRNCMIYLGYYF 125
            ||.|:|.:||||||:   |.|.|::       :|:.|.:..     |.|.| |.|...:.||::.
Yeast    63 LLNGYWFVFLLNLPV---LAYNLNK-------IYNKVQLLDATEIFRTLGK-HKRESFLKLGFHL 116

  Fly   126 VMFFVGLYCLISSLI--KGD 143
            :|||..||.:|.:||  .||
Yeast   117 LMFFFYLYRMIMALIAESGD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cnirNP_608745.1 Cornichon 8..133 CDD:397410 44/129 (34%)
ERV14NP_011461.1 Cornichon 3..124 CDD:397410 45/136 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5932
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59615
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - O PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.